Pectobacterium parmentieri RNS 08-42-1A: A8F97_12050 Help Entry A8F97_12050       CDS       T04513                                  Name (GenBank) hypothetical protein   KO K14188   D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13] Organism ppar  Pectobacterium parmentieri RNS 08-42-1A Pathway ppar00470   D-Amino acid metabolism ppar00552   Teichoic acid biosynthesis ppar01100   Metabolic pathways ppar01503   Cationic antimicrobial peptide (CAMP) resistance ppar02020   Two-component system Brite KEGG Orthology (KO) [BR:ppar00001]  09100 Metabolism   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     A8F97_12050   09107 Glycan biosynthesis and metabolism    00552 Teichoic acid biosynthesis     A8F97_12050  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     A8F97_12050  09160 Human Diseases   09175 Drug resistance: antimicrobial    01503 Cationic antimicrobial peptide (CAMP) resistance     A8F97_12050  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:ppar01504]     A8F97_12050 Enzymes [BR:ppar01000]  6. Ligases   6.1  Forming carbon-oxygen bonds    6.1.1  Ligases forming aminoacyl-tRNA and related compounds     6.1.1.13  D-alanine---poly(phosphoribitol) ligase      A8F97_12050 Antimicrobial resistance genes [BR:ppar01504]  Gene sets   CAMP resistance modules    Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]     A8F97_12050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOR59631 UniProt:  A0A0H3I401 LinkDB All DBs Position complement(2646626..2646847) Genome browser AA seq 73 aa AA seqDB search MEQEILALFEKILSRKVGFNDELIESDILDSILAVDLVLEVQDVYGCVIPPTEVATVLKT PAELARYIEENRG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggaacaagaaatactcgcgctgtttgaaaagatcttatcccgtaaagtgggctttaat gatgaactgattgagtccgatattctcgactctattctggcggtcgatttggtgctggaa gtgcaggacgtttacggctgtgtgatcccgccaactgaagtcgctaccgttctgaagacc ccagcagaattggctcgctacattgaagagaaccgcggctaa

DBGET integrated database retrieval system