KEGG   Pectobacterium parvum: LOZ86_10735
Entry
LOZ86_10735       CDS       T07916                                 
Name
(GenBank) NleE/OspZ family T3SS effector cysteine methyltransferase
  KO
K23654  T3SS secreted effector NleE
Organism
ppav  Pectobacterium parvum
SSDB
Motif
Pfam: NleE GOLGA2L5 FBPase_glpX
Other DBs
NCBI-ProteinID: UFK37483
LinkDB
Position
2365133..2366314
AA seq 393 aa
MKVSSIKEQLVVLSEYNNSAAIIKKIYPDIRASFFSEKPNVYDQSYIIGSTREAATFKLD
GYINKKIAIDSDIKKMYSECLINTDGISPSEANTREGSWGTVISGRRPVGQFSVDSLYSP
ELHVILELPNIGCKIFPKENNDFLYMIVVYRKNCEQGEKHANRFVELYNEKIELMSALAD
ESHETKVIKSELVIAREMGRILSYLPEEIDNYMHKLNSSALQTSATPHISDKVKNNSRHT
KIIIGCGELHKRKMMDEGTHIGEHLQCDTMDLDPNMGSSILADVTLPLHPQMHNKYNAVM
CEGLPPEVYHSDMFYTNLKLMTQNKASFVFSGLTENTKKILTEKLKSHRLNFSETESISD
LPQSLFIDEELFWNMRLEYSAEFKKHPPVVANK
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgaaagtttccagtattaaagagcagctggttgttttatcagaatataataattcagca
gcaatcataaaaaaaatctacccagatatcagagcttcttttttttcagaaaaacccaat
gtatatgaccaaagttacataataggttcaaccagagaggcagcaacgtttaaacttgat
ggatacattaataaaaaaatagccatagattctgatattaaaaagatgtactcggaatgc
ttaattaatactgacggcatttcccccagtgaggctaacacccgagagggaagttggggg
actgttatttcagggaggcgtccagtgggacaattttctgttgatagcctgtattcacca
gaattacacgtaatacttgaattgccaaatatcggttgtaagattttccccaaagaaaac
aatgattttttatatatgatagtagtatacagaaaaaattgtgaacaaggggaaaagcat
gcaaatcgttttgttgaattatacaatgaaaagatagagttaatgagtgcgctagcagat
gaatcgcatgagacgaaagttataaagtcagaactggttattgcgagggaaatgggcaga
atattaagctatttgccagaagaaatagacaactacatgcataaactgaattcgtctgct
ttacaaacgtcagcaacgccacacattagtgataaagtaaaaaacaattctcgccataca
aaaataataataggatgtggagagttgcacaaaaggaaaatgatggatgaaggaacccat
ataggcgaacatttacaatgtgatactatggatttagatccaaatatgggaagcagcatt
ttagctgacgtaacgttaccgttacatccgcaaatgcataataaatacaatgcagtaatg
tgtgaaggattaccgccggaagtgtatcattctgatatgttttatacaaatcttaagttg
atgacgcaaaacaaagcatcatttgtttttagtgggctaacagaaaacaccaaaaaaatt
ctaactgaaaaattgaaatctcacaggctgaacttctcagaaactgaaagtatatcagat
ctccctcagtcactgtttatagatgaggaattgttctggaatatgaggttagaatactca
gcagaatttaagaagcatccaccagttgttgctaataaataa

DBGET integrated database retrieval system