Pediococcus pentosaceus ATCC 25745: PEPE_0678 Help Entry PEPE_0678         CDS       T00409                                  Name (GenBank) hypothetical protein   KO K04453   Max protein Organism ppe  Pediococcus pentosaceus ATCC 25745 Brite KEGG Orthology (KO) [BR:ppe00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     PEPE_0678  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ppe03000]     PEPE_0678    03036 Chromosome and associated proteins [BR:ppe03036]     PEPE_0678 Transcription factors [BR:ppe03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     PEPE_0678 Chromosome and associated proteins [BR:ppe03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      PEPE_0678 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tropomyosin Spectrin Tektin Baculo_PEP_C DUF948 SHE3 BORCS6 DUF16 TPR_MLP1_2 DUF4763 PspA_IM30 Seryl_tRNA_N HrpB7 Laminin_II Fib_alpha DUF4164 YlqD DUF4795 LXG DUF3452 Fungal_TACC Striatin Phage_int_SAM_2 BLOC1_2 TMPIT FapA Motif Other DBs NCBI-ProteinID:  ABJ67739 UniProt:  Q03GD3 LinkDB All DBs Position complement(719450..719815) Genome browser AA seq 121 aa AA seqDB search MAKKTKKHSWLKWSIGTWAGFKGVEYLLNHPHFIRDFKISMKEYFTNLSEFVDSLQSLKA NSAQLQVELKKAERTVNQITKSVDRFEYKLDPRIEKINELKKHINSEIDHLQDQILDKKR K NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaaaaactaagaagcattcatggttaaagtggtccatcggaacttgggctggt tttaaaggtgtcgaatatcttcttaaccatccccatttcatccgtgattttaaaatatcg atgaaggaatactttaccaatttaagtgaatttgttgactcacttcaaagtttaaaggct aactcggctcaactccaagttgaattaaaaaaagctgagcgaacggtcaaccaaattact aaatcggtggatcgctttgaatataaactcgaccctcgcattgaaaaaattaatgaacta aaaaaacacataaatagcgaaattgatcatttacaagaccaaatcttggataaaaaaaga aaatga

DBGET integrated database retrieval system