Prunus persica (peach): 18785603 Help Entry 18785603          CDS       T03092                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pper  Prunus persica (peach) Pathway pper03420   Nucleotide excision repair pper04120   Ubiquitin mediated proteolysis pper04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     18785603    04120 Ubiquitin mediated proteolysis     18785603   09124 Replication and repair    03420 Nucleotide excision repair     18785603  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pper04121]     18785603    03400 DNA repair and recombination proteins [BR:pper03400]     18785603 Enzymes [BR:pper01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      18785603 Ubiquitin system [BR:pper04121]  Ubiquitin ligases (E3)   UBL E3 ligases    18785603   Multi subunit type E3    SCF complex     Ring finger protein      18785603    Cul2 complex      18785603    Cul3 complex      18785603    Cul4 complex      18785603    Cul7 complex      18785603    Cul8 complex      18785603    Cul9 complex      18785603 DNA repair and recombination proteins [BR:pper03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       18785603     TCR (transcription coupled repair) factors      Cul4-CSA complex       18785603 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  18785603 NCBI-ProteinID:  XP_007218619 UniProt:  M5XE81 LinkDB All DBs Position G2:20696266..20698948 Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMVPVGEASSSAGSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgacattggattcagatgtgcctatggttccggtaggcgaggcttcaagcagtgca ggttcatcgaccaagaagcccaagcgatttgagatcaagaagtggaatgctgtcgctctc tgggcctgggatattgttgttgataactgtgccatttgcaggaaccatatcatggatctc tgcattgagtgccaagcaaaccaggcaagcgccacaagcgaggagtgtacagttgcttgg ggggtttgcaaccatgcattccactttcactgcataagccgatggctcaagacccgccaa gtgtgtccattagataatagcgagtgggagtttcagaagtatggtcattag

DBGET integrated database retrieval system