Prunus persica (peach): 18786902 Help Entry 18786902          CDS       T03092                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pper  Prunus persica (peach) Pathway pper03420   Nucleotide excision repair pper04120   Ubiquitin mediated proteolysis pper04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     18786902    04120 Ubiquitin mediated proteolysis     18786902   09124 Replication and repair    03420 Nucleotide excision repair     18786902  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pper04121]     18786902    03400 DNA repair and recombination proteins [BR:pper03400]     18786902 Enzymes [BR:pper01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      18786902 Ubiquitin system [BR:pper04121]  Ubiquitin ligases (E3)   UBL E3 ligases    18786902   Multi subunit type E3    SCF complex     Ring finger protein      18786902    Cul2 complex      18786902    Cul3 complex      18786902    Cul4 complex      18786902    Cul7 complex      18786902    Cul8 complex      18786902    Cul9 complex      18786902 DNA repair and recombination proteins [BR:pper03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       18786902     TCR (transcription coupled repair) factors      Cul4-CSA complex       18786902 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  18786902 NCBI-ProteinID:  XP_007218617 UniProt:  M5X2V0 LinkDB All DBs Position G2:20723679..20726093 Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMVPVGEASSSAGPSSTKRPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggccacattggactctgacgtgccgatggttccggtgggcgaggcttcgagcagtgct ggtccttcttcgaccaagaggcccaagcggttcgagatcaagaagtggaatgctgttgct ctctgggcttgggatattgtggttgataactgtgccatttgcaggaaccatatcatggat ctctgcatcgagtgccaagcgaaccaggcaagtgccacaagtgaggagtgtacggttgct tggggggtctgtaaccatgcattccacttccattgcataagccgatggctgaaaacgcgc caagtgtgtccgttggataacagtgagtgggagtttcagaagtacggtcactag

DBGET integrated database retrieval system