Phocoena phocoena (harbor porpoise): 136117901 Help Entry 136117901         CDS       T11058                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc01522   Endocrine resistance pphc04010   MAPK signaling pathway pphc04024   cAMP signaling pathway pphc04210   Apoptosis pphc04380   Osteoclast differentiation pphc04620   Toll-like receptor signaling pathway pphc04657   IL-17 signaling pathway pphc04658   Th1 and Th2 cell differentiation pphc04659   Th17 cell differentiation pphc04660   T cell receptor signaling pathway pphc04662   B cell receptor signaling pathway pphc04668   TNF signaling pathway pphc04713   Circadian entrainment pphc04725   Cholinergic synapse pphc04728   Dopaminergic synapse pphc04915   Estrogen signaling pathway pphc04917   Prolactin signaling pathway pphc04921   Oxytocin signaling pathway pphc04926   Relaxin signaling pathway pphc04928   Parathyroid hormone synthesis, secretion and action pphc04932   Non-alcoholic fatty liver disease pphc04935   Growth hormone synthesis, secretion and action pphc05031   Amphetamine addiction pphc05132   Salmonella infection pphc05133   Pertussis pphc05135   Yersinia infection pphc05140   Leishmaniasis pphc05142   Chagas disease pphc05161   Hepatitis B pphc05162   Measles pphc05166   Human T-cell leukemia virus 1 infection pphc05167   Kaposi sarcoma-associated herpesvirus infection pphc05170   Human immunodeficiency virus 1 infection pphc05171   Coronavirus disease - COVID-19 pphc05200   Pathways in cancer pphc05207   Chemical carcinogenesis - receptor activation pphc05208   Chemical carcinogenesis - reactive oxygen species pphc05210   Colorectal cancer pphc05224   Breast cancer pphc05231   Choline metabolism in cancer pphc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pphc05323   Rheumatoid arthritis pphc05417   Lipid and atherosclerosis pphc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136117901 (FOS)    04668 TNF signaling pathway     136117901 (FOS)    04024 cAMP signaling pathway     136117901 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     136117901 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136117901 (FOS)    04660 T cell receptor signaling pathway     136117901 (FOS)    04658 Th1 and Th2 cell differentiation     136117901 (FOS)    04659 Th17 cell differentiation     136117901 (FOS)    04657 IL-17 signaling pathway     136117901 (FOS)    04662 B cell receptor signaling pathway     136117901 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     136117901 (FOS)    04917 Prolactin signaling pathway     136117901 (FOS)    04921 Oxytocin signaling pathway     136117901 (FOS)    04926 Relaxin signaling pathway     136117901 (FOS)    04935 Growth hormone synthesis, secretion and action     136117901 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     136117901 (FOS)   09156 Nervous system    04725 Cholinergic synapse     136117901 (FOS)    04728 Dopaminergic synapse     136117901 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     136117901 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     136117901 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136117901 (FOS)    05207 Chemical carcinogenesis - receptor activation     136117901 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     136117901 (FOS)    05231 Choline metabolism in cancer     136117901 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     136117901 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     136117901 (FOS)    05224 Breast cancer     136117901 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136117901 (FOS)    05170 Human immunodeficiency virus 1 infection     136117901 (FOS)    05161 Hepatitis B     136117901 (FOS)    05171 Coronavirus disease - COVID-19     136117901 (FOS)    05162 Measles     136117901 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     136117901 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     136117901 (FOS)    05135 Yersinia infection     136117901 (FOS)    05133 Pertussis     136117901 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     136117901 (FOS)    05142 Chagas disease     136117901 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     136117901 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     136117901 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136117901 (FOS)    05418 Fluid shear stress and atherosclerosis     136117901 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     136117901 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     136117901 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pphc03000]     136117901 (FOS)    04131 Membrane trafficking [BR:pphc04131]     136117901 (FOS) Transcription factors [BR:pphc03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     136117901 (FOS) Membrane trafficking [BR:pphc04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     136117901 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  136117901 NCBI-ProteinID:  XP_065726959 LinkDB All DBs Position 2:complement(27071943..27075388) Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMSGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDMGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc tccccggccggggacagcctctcctactaccactcaccggccgactccttctccagtatg ggctctcccgtcaatgcgcaggacttctgcaccgatctggccgtctccagtgccaacttc atcccaacagtgacagccatctcgaccagcccggacctgcagtggctagtgcagcccacc ctggtctcctccgtggccccatcccagaccagagccccccacccctatggagtccccacc ccctcggctggggcttactccagggctggggtcatgaagaccatgagcggaggcagagct cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaggagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag ctgactgacacactccaagcggaaacagaccaactagaagatgagaagtctgctttgcag actgagattgccaacctgctaaaggagaaggaaaaactagagttcatcttggcggctcac cgacctgcttgcaagatccctgatgacatgggcttcccagaagaaatgtctgtggcttcc cttgatctgagtgggggcctgcctgaagccgccacccccgaatctgaggaggccttcacc ctacccctccttaatgaccctgagcccaagccctcagtggagcccgtcaagagcatcagc agcatggagctgaaggctgagccctttgatgacttcctgttcccagcatcgtccaggccc agcggctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacggtggctccctggggatggggcccatggccacagagctg gaacccctgtgtaccccggtggtcacctgtacacccagctgcactacttacacgtcttcc tttgtcttcacctaccctgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcgctcagctcacccacgctcctggccctg tga

DBGET integrated database retrieval system