Phocoena phocoena (harbor porpoise): 136121431 Help Entry 136121431         CDS       T11058                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04060   Cytokine-cytokine receptor interaction pphc04151   PI3K-Akt signaling pathway pphc04630   JAK-STAT signaling pathway pphc04640   Hematopoietic cell lineage pphc04657   IL-17 signaling pathway pphc04658   Th1 and Th2 cell differentiation pphc04659   Th17 cell differentiation pphc04660   T cell receptor signaling pathway pphc04664   Fc epsilon RI signaling pathway pphc04672   Intestinal immune network for IgA production pphc05140   Leishmaniasis pphc05200   Pathways in cancer pphc05310   Asthma pphc05320   Autoimmune thyroid disease pphc05321   Inflammatory bowel disease pphc05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     136121431 (IL4)    04151 PI3K-Akt signaling pathway     136121431 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136121431 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     136121431 (IL4)    04660 T cell receptor signaling pathway     136121431 (IL4)    04658 Th1 and Th2 cell differentiation     136121431 (IL4)    04659 Th17 cell differentiation     136121431 (IL4)    04657 IL-17 signaling pathway     136121431 (IL4)    04664 Fc epsilon RI signaling pathway     136121431 (IL4)    04672 Intestinal immune network for IgA production     136121431 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136121431 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     136121431 (IL4)   09163 Immune disease    05310 Asthma     136121431 (IL4)    05320 Autoimmune thyroid disease     136121431 (IL4)    05321 Inflammatory bowel disease     136121431 (IL4)    05330 Allograft rejection     136121431 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136121431 (IL4)    00536 Glycosaminoglycan binding proteins [BR:pphc00536]     136121431 (IL4) Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Interleukins    136121431 (IL4) Glycosaminoglycan binding proteins [BR:pphc00536]  Heparan sulfate / Heparin   Cytokines    136121431 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 RHG29_45_N Motif Other DBs NCBI-GeneID:  136121431 NCBI-ProteinID:  XP_065731392 LinkDB All DBs Position 3:110819136..110828192 Genome browser AA seq 133 aa AA seqDB search MGLTSQLIPMLVCLLACTSNFIHGHKCDITLQEIIKTLNILTARKNLCMELPVEDVFATT KNTTEKETFCRAGTVLRHIYRYHKCFNKPLSGLHRNLSSMANMTCSVNEAKKSTLKDFLE TLKTIMKEKYSKC NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgatcccaatgctagtctgcttactggcatgtaccagcaac ttcatccatggacacaagtgtgatattaccttacaagagatcatcaaaacgctgaacatc ctcacagcaagaaagaacttgtgcatggagctgcctgtagaagacgtctttgccaccaca aagaacacaactgagaaggaaactttctgcagggccgggactgtgcttcggcatatctac agataccacaagtgcttcaacaaacccctgagtggacttcacaggaacctcagcagcatg gcaaacatgacctgttctgtgaatgaagccaagaagagtacgttgaaagacttcttggaa acgctaaagacgattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system