Phocoena phocoena (harbor porpoise): 136123082 Help Entry 136123082         CDS       T11058                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc01521   EGFR tyrosine kinase inhibitor resistance pphc04010   MAPK signaling pathway pphc04014   Ras signaling pathway pphc04015   Rap1 signaling pathway pphc04020   Calcium signaling pathway pphc04151   PI3K-Akt signaling pathway pphc04550   Signaling pathways regulating pluripotency of stem cells pphc04810   Regulation of actin cytoskeleton pphc05167   Kaposi sarcoma-associated herpesvirus infection pphc05200   Pathways in cancer pphc05205   Proteoglycans in cancer pphc05207   Chemical carcinogenesis - receptor activation pphc05218   Melanoma pphc05224   Breast cancer pphc05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136123082 (FGF2)    04014 Ras signaling pathway     136123082 (FGF2)    04015 Rap1 signaling pathway     136123082 (FGF2)    04020 Calcium signaling pathway     136123082 (FGF2)    04151 PI3K-Akt signaling pathway     136123082 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     136123082 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     136123082 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136123082 (FGF2)    05205 Proteoglycans in cancer     136123082 (FGF2)    05207 Chemical carcinogenesis - receptor activation     136123082 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     136123082 (FGF2)    05218 Melanoma     136123082 (FGF2)    05224 Breast cancer     136123082 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     136123082 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     136123082 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136123082 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:pphc00536]     136123082 (FGF2) Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Growth factors (RTK binding)    136123082 (FGF2) Glycosaminoglycan binding proteins [BR:pphc00536]  Heparan sulfate / Heparin   Growth factors/receptors    136123082 (FGF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  136123082 NCBI-ProteinID:  XP_065733218 LinkDB All DBs Position 5:120806269..120862168 Genome browser AA seq 155 aa AA seqDB search MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHV KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcagccgggagcatcaccacgctgcccgccctgccggaggacggcggcagcggcgcc ttcccgcccggccacttcaaggacccgaagaggctgtactgcaaaaacgggggcttcttc ctgcgcatccaccccgacggccgagtggacggggtccgcgagaagagcgaccctcacgtc aaactacaacttcaagcagaagagagaggggttgtgtctatcaaaggagtgtgtgcgaac cgttaccttgctatgaaggaagatggaagattactggcttctaaatgtgttacagacgag tgtttcttttttgaacgactggaatctaataactacaatacttaccggtcaaggaaatac tccagttggtatgtggcactgaagcgaactgggcagtataaacttggccccaaaacagga cctgggcagaaagctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system