Phocoena phocoena (harbor porpoise): 136123500 Help Entry 136123500         CDS       T11058                                  Name (RefSeq) thymosin beta-4   KO K05764   thymosin, beta 4 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pphc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     136123500  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pphc04812]     136123500 Cytoskeleton proteins [BR:pphc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      136123500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin Qua1 WH2 Motif Other DBs NCBI-GeneID:  136123500 NCBI-ProteinID:  XP_065733842 LinkDB All DBs Position 5:complement(93298796..93298930) Genome browser AA seq 44 aa AA seqDB search MSDKPDMAEIEKFDKSKLKKTETKEKNPLPSQETIEQEKQAGES NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaagcccgatatggctgagattgagaaattcgataagtcgaaactgaagaaa acagaaacgaaagagaaaaatccactgccttcacaagaaacgattgaacaggagaagcaa gcaggcgagtcgtaa

DBGET integrated database retrieval system