Phocoena phocoena (harbor porpoise): 136128097 Help Entry 136128097         CDS       T11058                                  Symbol IL6 Name (RefSeq) interleukin-6 isoform X1   KO K05405   interleukin 6 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc01521   EGFR tyrosine kinase inhibitor resistance pphc01523   Antifolate resistance pphc04060   Cytokine-cytokine receptor interaction pphc04061   Viral protein interaction with cytokine and cytokine receptor pphc04066   HIF-1 signaling pathway pphc04068   FoxO signaling pathway pphc04151   PI3K-Akt signaling pathway pphc04218   Cellular senescence pphc04620   Toll-like receptor signaling pathway pphc04621   NOD-like receptor signaling pathway pphc04623   Cytosolic DNA-sensing pathway pphc04625   C-type lectin receptor signaling pathway pphc04630   JAK-STAT signaling pathway pphc04640   Hematopoietic cell lineage pphc04657   IL-17 signaling pathway pphc04659   Th17 cell differentiation pphc04668   TNF signaling pathway pphc04672   Intestinal immune network for IgA production pphc04931   Insulin resistance pphc04932   Non-alcoholic fatty liver disease pphc04933   AGE-RAGE signaling pathway in diabetic complications pphc04936   Alcoholic liver disease pphc05010   Alzheimer disease pphc05020   Prion disease pphc05022   Pathways of neurodegeneration - multiple diseases pphc05132   Salmonella infection pphc05133   Pertussis pphc05134   Legionellosis pphc05135   Yersinia infection pphc05142   Chagas disease pphc05143   African trypanosomiasis pphc05144   Malaria pphc05146   Amoebiasis pphc05152   Tuberculosis pphc05161   Hepatitis B pphc05162   Measles pphc05163   Human cytomegalovirus infection pphc05164   Influenza A pphc05166   Human T-cell leukemia virus 1 infection pphc05167   Kaposi sarcoma-associated herpesvirus infection pphc05168   Herpes simplex virus 1 infection pphc05169   Epstein-Barr virus infection pphc05171   Coronavirus disease - COVID-19 pphc05200   Pathways in cancer pphc05202   Transcriptional misregulation in cancer pphc05321   Inflammatory bowel disease pphc05323   Rheumatoid arthritis pphc05332   Graft-versus-host disease pphc05410   Hypertrophic cardiomyopathy pphc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     136128097 (IL6)    04668 TNF signaling pathway     136128097 (IL6)    04066 HIF-1 signaling pathway     136128097 (IL6)    04068 FoxO signaling pathway     136128097 (IL6)    04151 PI3K-Akt signaling pathway     136128097 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136128097 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     136128097 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     136128097 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     136128097 (IL6)    04620 Toll-like receptor signaling pathway     136128097 (IL6)    04621 NOD-like receptor signaling pathway     136128097 (IL6)    04623 Cytosolic DNA-sensing pathway     136128097 (IL6)    04625 C-type lectin receptor signaling pathway     136128097 (IL6)    04659 Th17 cell differentiation     136128097 (IL6)    04657 IL-17 signaling pathway     136128097 (IL6)    04672 Intestinal immune network for IgA production     136128097 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136128097 (IL6)    05202 Transcriptional misregulation in cancer     136128097 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136128097 (IL6)    05161 Hepatitis B     136128097 (IL6)    05171 Coronavirus disease - COVID-19     136128097 (IL6)    05164 Influenza A     136128097 (IL6)    05162 Measles     136128097 (IL6)    05168 Herpes simplex virus 1 infection     136128097 (IL6)    05163 Human cytomegalovirus infection     136128097 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     136128097 (IL6)    05169 Epstein-Barr virus infection     136128097 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     136128097 (IL6)    05135 Yersinia infection     136128097 (IL6)    05133 Pertussis     136128097 (IL6)    05134 Legionellosis     136128097 (IL6)    05152 Tuberculosis     136128097 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     136128097 (IL6)    05144 Malaria     136128097 (IL6)    05142 Chagas disease     136128097 (IL6)    05143 African trypanosomiasis     136128097 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     136128097 (IL6)    05321 Inflammatory bowel disease     136128097 (IL6)    05332 Graft-versus-host disease     136128097 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     136128097 (IL6)    05020 Prion disease     136128097 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     136128097 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136128097 (IL6)    05410 Hypertrophic cardiomyopathy     136128097 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     136128097 (IL6)    04932 Non-alcoholic fatty liver disease     136128097 (IL6)    04931 Insulin resistance     136128097 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     136128097 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     136128097 (IL6)    01523 Antifolate resistance     136128097 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136128097 (IL6) Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Interleukins    136128097 (IL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 GCSF IL23 Sec16 Motif Other DBs NCBI-GeneID:  136128097 NCBI-ProteinID:  XP_065739869 LinkDB All DBs Position 9:complement(31231962..31235999) Genome browser AA seq 213 aa AA seqDB search MNSLSTSTSGTVAFSLGLLLVTATAFPTPGPLGEDFKDDTTSDRLLLTSPDKTEALIKYI LGKISAMRKEMCEKYDKCENSKEALAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLL EYQIYLDYLQNGYEGDKGSVEAVQISIKALAQILRQKVKNPDEVTTPDPTTNASLMNNLQ SQNDDWMKNTKFILILRSLENFLQFSLRAVRIK NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atgaactccctctccacaagtacctccggcacagtcgccttctccctgggactgctcctg gtgacggctactgctttccctaccccgggacccctgggagaagatttcaaagatgatacc acttcagacagactactcctcacctctccagacaaaactgaagctctcattaagtacatc ctcggcaaaatctccgcaatgagaaaggagatgtgtgagaagtatgacaagtgtgaaaac agcaaggaggcactggcagaaaacaatctgaaccttcccaaaatggcagaaaaagacgga tgcttccaatctgggttcaatcaggagacttgcttgatgagaatcaccaccggtcttctg gagtatcagatatacctggactacctccagaacgggtatgagggtgacaagggaagcgtc gaggctgtgcagattagcatcaaagcactggcccagatcctgaggcaaaaggtcaagaat ccagatgaagtaaccacccctgacccaactacaaatgccagcctgatgaataacctgcag tcgcagaacgatgactggatgaagaacacaaagtttatcctcatcctgcgaagccttgag aacttcctgcagttcagcctgagggctgttcggatcaagtag

DBGET integrated database retrieval system