Phocoena phocoena (harbor porpoise): 136130037 Help Entry 136130037         CDS       T11058                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc01523   Antifolate resistance pphc04010   MAPK signaling pathway pphc04060   Cytokine-cytokine receptor interaction pphc04061   Viral protein interaction with cytokine and cytokine receptor pphc04064   NF-kappa B signaling pathway pphc04071   Sphingolipid signaling pathway pphc04150   mTOR signaling pathway pphc04210   Apoptosis pphc04217   Necroptosis pphc04350   TGF-beta signaling pathway pphc04380   Osteoclast differentiation pphc04612   Antigen processing and presentation pphc04620   Toll-like receptor signaling pathway pphc04621   NOD-like receptor signaling pathway pphc04622   RIG-I-like receptor signaling pathway pphc04625   C-type lectin receptor signaling pathway pphc04640   Hematopoietic cell lineage pphc04650   Natural killer cell mediated cytotoxicity pphc04657   IL-17 signaling pathway pphc04660   T cell receptor signaling pathway pphc04664   Fc epsilon RI signaling pathway pphc04668   TNF signaling pathway pphc04920   Adipocytokine signaling pathway pphc04930   Type II diabetes mellitus pphc04931   Insulin resistance pphc04932   Non-alcoholic fatty liver disease pphc04933   AGE-RAGE signaling pathway in diabetic complications pphc04936   Alcoholic liver disease pphc04940   Type I diabetes mellitus pphc05010   Alzheimer disease pphc05014   Amyotrophic lateral sclerosis pphc05020   Prion disease pphc05022   Pathways of neurodegeneration - multiple diseases pphc05132   Salmonella infection pphc05133   Pertussis pphc05134   Legionellosis pphc05135   Yersinia infection pphc05140   Leishmaniasis pphc05142   Chagas disease pphc05143   African trypanosomiasis pphc05144   Malaria pphc05145   Toxoplasmosis pphc05146   Amoebiasis pphc05152   Tuberculosis pphc05160   Hepatitis C pphc05161   Hepatitis B pphc05163   Human cytomegalovirus infection pphc05164   Influenza A pphc05165   Human papillomavirus infection pphc05166   Human T-cell leukemia virus 1 infection pphc05168   Herpes simplex virus 1 infection pphc05169   Epstein-Barr virus infection pphc05170   Human immunodeficiency virus 1 infection pphc05171   Coronavirus disease - COVID-19 pphc05205   Proteoglycans in cancer pphc05310   Asthma pphc05321   Inflammatory bowel disease pphc05322   Systemic lupus erythematosus pphc05323   Rheumatoid arthritis pphc05330   Allograft rejection pphc05332   Graft-versus-host disease pphc05410   Hypertrophic cardiomyopathy pphc05414   Dilated cardiomyopathy pphc05417   Lipid and atherosclerosis pphc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136130037 (TNF)    04350 TGF-beta signaling pathway     136130037 (TNF)    04064 NF-kappa B signaling pathway     136130037 (TNF)    04668 TNF signaling pathway     136130037 (TNF)    04071 Sphingolipid signaling pathway     136130037 (TNF)    04150 mTOR signaling pathway     136130037 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136130037 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     136130037 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     136130037 (TNF)    04217 Necroptosis     136130037 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     136130037 (TNF)    04620 Toll-like receptor signaling pathway     136130037 (TNF)    04621 NOD-like receptor signaling pathway     136130037 (TNF)    04622 RIG-I-like receptor signaling pathway     136130037 (TNF)    04625 C-type lectin receptor signaling pathway     136130037 (TNF)    04650 Natural killer cell mediated cytotoxicity     136130037 (TNF)    04612 Antigen processing and presentation     136130037 (TNF)    04660 T cell receptor signaling pathway     136130037 (TNF)    04657 IL-17 signaling pathway     136130037 (TNF)    04664 Fc epsilon RI signaling pathway     136130037 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     136130037 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     136130037 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     136130037 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136130037 (TNF)    05170 Human immunodeficiency virus 1 infection     136130037 (TNF)    05161 Hepatitis B     136130037 (TNF)    05160 Hepatitis C     136130037 (TNF)    05171 Coronavirus disease - COVID-19     136130037 (TNF)    05164 Influenza A     136130037 (TNF)    05168 Herpes simplex virus 1 infection     136130037 (TNF)    05163 Human cytomegalovirus infection     136130037 (TNF)    05169 Epstein-Barr virus infection     136130037 (TNF)    05165 Human papillomavirus infection     136130037 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     136130037 (TNF)    05135 Yersinia infection     136130037 (TNF)    05133 Pertussis     136130037 (TNF)    05134 Legionellosis     136130037 (TNF)    05152 Tuberculosis     136130037 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     136130037 (TNF)    05144 Malaria     136130037 (TNF)    05145 Toxoplasmosis     136130037 (TNF)    05140 Leishmaniasis     136130037 (TNF)    05142 Chagas disease     136130037 (TNF)    05143 African trypanosomiasis     136130037 (TNF)   09163 Immune disease    05310 Asthma     136130037 (TNF)    05322 Systemic lupus erythematosus     136130037 (TNF)    05323 Rheumatoid arthritis     136130037 (TNF)    05321 Inflammatory bowel disease     136130037 (TNF)    05330 Allograft rejection     136130037 (TNF)    05332 Graft-versus-host disease     136130037 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     136130037 (TNF)    05014 Amyotrophic lateral sclerosis     136130037 (TNF)    05020 Prion disease     136130037 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     136130037 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136130037 (TNF)    05418 Fluid shear stress and atherosclerosis     136130037 (TNF)    05410 Hypertrophic cardiomyopathy     136130037 (TNF)    05414 Dilated cardiomyopathy     136130037 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     136130037 (TNF)    04940 Type I diabetes mellitus     136130037 (TNF)    04936 Alcoholic liver disease     136130037 (TNF)    04932 Non-alcoholic fatty liver disease     136130037 (TNF)    04931 Insulin resistance     136130037 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     136130037 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     136130037 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136130037 (TNF)    00536 Glycosaminoglycan binding proteins [BR:pphc00536]     136130037 (TNF) Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Tumor necrosis fators    136130037 (TNF) Glycosaminoglycan binding proteins [BR:pphc00536]  Heparan sulfate / Heparin   Cytokines    136130037 (TNF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  136130037 NCBI-ProteinID:  XP_065742507 LinkDB All DBs Position 10:complement(82157859..82160637) Genome browser AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALSKTAGGSQGSGRCLCLSLFSFLLVAGGTTLFCLLHFGVIGPQR EEFPTGYSIISPLAQTLRSSSKTSSNKPVAHVVANLSAQGQLRWLNTYANTLLANSVKLE DNQLVVPTDGLYLIYSQVLFRGQGCPPTHLFLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggatgtggagctggcagaggaggcgctctccaagacg gcagggggctcccagggttccggaaggtgcttgtgtctcagcctcttctccttcctcctg gtcgcaggaggcaccacgctcttctgcctgctgcacttcggggtaatcggcccccagagg gaagagttcccaactggctactccatcatcagccctctggctcagacactcagatcatct tctaaaacctcaagtaacaagcccgtagcccatgttgtagccaacctcagtgctcagggg cagctccggtggctgaacacatatgccaacaccctcctggccaacagcgtgaagctggaa gacaaccagctggtggtgccgacggacgggctgtacctcatctactcccaggtcctcttc aggggccaaggctgccctcccacccacttgttcctcacccacaccatcagccgcatcgct gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggag acgccagagggggctgaggccaagccctggtatgagcccatctaccagggaggggtcttc cagctggagaagggtgatcgactcagtgctgagatcaacctgcccgactatctggacttt gctgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system