Phocoena phocoena (harbor porpoise): 136130509 Help Entry 136130509         CDS       T11058                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc03050   Proteasome pphc04060   Cytokine-cytokine receptor interaction pphc04066   HIF-1 signaling pathway pphc04217   Necroptosis pphc04350   TGF-beta signaling pathway pphc04380   Osteoclast differentiation pphc04612   Antigen processing and presentation pphc04630   JAK-STAT signaling pathway pphc04650   Natural killer cell mediated cytotoxicity pphc04657   IL-17 signaling pathway pphc04658   Th1 and Th2 cell differentiation pphc04659   Th17 cell differentiation pphc04660   T cell receptor signaling pathway pphc04940   Type I diabetes mellitus pphc05140   Leishmaniasis pphc05142   Chagas disease pphc05143   African trypanosomiasis pphc05144   Malaria pphc05145   Toxoplasmosis pphc05146   Amoebiasis pphc05152   Tuberculosis pphc05160   Hepatitis C pphc05164   Influenza A pphc05168   Herpes simplex virus 1 infection pphc05200   Pathways in cancer pphc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pphc05321   Inflammatory bowel disease pphc05322   Systemic lupus erythematosus pphc05323   Rheumatoid arthritis pphc05330   Allograft rejection pphc05332   Graft-versus-host disease pphc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     136130509 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     136130509 (IFNG)    04630 JAK-STAT signaling pathway     136130509 (IFNG)    04066 HIF-1 signaling pathway     136130509 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136130509 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136130509 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     136130509 (IFNG)    04612 Antigen processing and presentation     136130509 (IFNG)    04660 T cell receptor signaling pathway     136130509 (IFNG)    04658 Th1 and Th2 cell differentiation     136130509 (IFNG)    04659 Th17 cell differentiation     136130509 (IFNG)    04657 IL-17 signaling pathway     136130509 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     136130509 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136130509 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     136130509 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     136130509 (IFNG)    05164 Influenza A     136130509 (IFNG)    05168 Herpes simplex virus 1 infection     136130509 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     136130509 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     136130509 (IFNG)    05144 Malaria     136130509 (IFNG)    05145 Toxoplasmosis     136130509 (IFNG)    05140 Leishmaniasis     136130509 (IFNG)    05142 Chagas disease     136130509 (IFNG)    05143 African trypanosomiasis     136130509 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     136130509 (IFNG)    05323 Rheumatoid arthritis     136130509 (IFNG)    05321 Inflammatory bowel disease     136130509 (IFNG)    05330 Allograft rejection     136130509 (IFNG)    05332 Graft-versus-host disease     136130509 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     136130509 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     136130509 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:pphc03051]     136130509 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136130509 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:pphc00536]     136130509 (IFNG) Proteasome [BR:pphc03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     136130509 (IFNG) Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Interferons    136130509 (IFNG) Glycosaminoglycan binding proteins [BR:pphc00536]  Heparan sulfate / Heparin   Cytokines    136130509 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma API5 Motif Other DBs NCBI-GeneID:  136130509 NCBI-ProteinID:  XP_065743026 LinkDB All DBs Position 11:48562059..48566983 Genome browser AA seq 166 aa AA seqDB search MKYTSYFLAFQLCVILGSSGFYCQAPFFKEIQNLKEYFNASNPDVAGGGPLFLQILENWK DESDKKIIQSQIVSFYFKLFENLKGNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFKKLIQ IPVDDLQIQRKAISELIKVMKDLSPRSNLRKRRRSQNLFRGQRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatataccagttatttcttagcttttcagctatgcgtgattttgggttcttctggc ttttactgccaggccccattttttaaagaaatacaaaacctaaaggaatattttaatgca agtaacccagatgtagctggtggtgggcctcttttcttacaaattttggagaattggaaa gatgagagtgacaaaaaaataattcagagccaaatcgtctccttctacttcaaactcttt gaaaacttaaaaggtaaccagatcattcaaaggagcatggatatcatcaagcaggacatg tttcagaagttcttaaatggcagctctgagaaactggatgacttcaaaaagctgattcaa attccggtagatgatctgcagatccagcgcaaagccataagtgaactcatcaaagtgatg aaggacctgtcgccaagatctaacctcagaaagcggaggagaagtcagaatctgtttcga ggccagagagcgtcgaaataa

DBGET integrated database retrieval system