Phocoena phocoena (harbor porpoise): 136138031 Help Entry 136138031         CDS       T11058                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2 isoform X1   KO K05692   actin beta/gamma 1 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc03082   ATP-dependent chromatin remodeling pphc04015   Rap1 signaling pathway pphc04145   Phagosome pphc04210   Apoptosis pphc04390   Hippo signaling pathway pphc04510   Focal adhesion pphc04520   Adherens junction pphc04530   Tight junction pphc04611   Platelet activation pphc04613   Neutrophil extracellular trap formation pphc04670   Leukocyte transendothelial migration pphc04714   Thermogenesis pphc04810   Regulation of actin cytoskeleton pphc04814   Motor proteins pphc04820   Cytoskeleton in muscle cells pphc04919   Thyroid hormone signaling pathway pphc04921   Oxytocin signaling pathway pphc04971   Gastric acid secretion pphc05014   Amyotrophic lateral sclerosis pphc05100   Bacterial invasion of epithelial cells pphc05132   Salmonella infection pphc05135   Yersinia infection pphc05164   Influenza A pphc05205   Proteoglycans in cancer pphc05225   Hepatocellular carcinoma pphc05410   Hypertrophic cardiomyopathy pphc05412   Arrhythmogenic right ventricular cardiomyopathy pphc05414   Dilated cardiomyopathy pphc05416   Viral myocarditis pphc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     136138031 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     136138031 (ACTG1)    04390 Hippo signaling pathway     136138031 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     136138031 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     136138031 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     136138031 (ACTG1)    04520 Adherens junction     136138031 (ACTG1)    04530 Tight junction     136138031 (ACTG1)   09142 Cell motility    04814 Motor proteins     136138031 (ACTG1)    04820 Cytoskeleton in muscle cells     136138031 (ACTG1)    04810 Regulation of actin cytoskeleton     136138031 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     136138031 (ACTG1)    04613 Neutrophil extracellular trap formation     136138031 (ACTG1)    04670 Leukocyte transendothelial migration     136138031 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     136138031 (ACTG1)    04919 Thyroid hormone signaling pathway     136138031 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     136138031 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     136138031 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     136138031 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     136138031 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     136138031 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     136138031 (ACTG1)    05135 Yersinia infection     136138031 (ACTG1)    05100 Bacterial invasion of epithelial cells     136138031 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     136138031 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     136138031 (ACTG1)    05410 Hypertrophic cardiomyopathy     136138031 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     136138031 (ACTG1)    05414 Dilated cardiomyopathy     136138031 (ACTG1)    05416 Viral myocarditis     136138031 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pphc03021]     136138031 (ACTG1)    03019 Messenger RNA biogenesis [BR:pphc03019]     136138031 (ACTG1)    03036 Chromosome and associated proteins [BR:pphc03036]     136138031 (ACTG1)    03029 Mitochondrial biogenesis [BR:pphc03029]     136138031 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pphc04812]     136138031 (ACTG1)    04147 Exosome [BR:pphc04147]     136138031 (ACTG1) Transcription machinery [BR:pphc03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      136138031 (ACTG1) Messenger RNA biogenesis [BR:pphc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      136138031 (ACTG1) Chromosome and associated proteins [BR:pphc03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      136138031 (ACTG1)     NuA4 complex      136138031 (ACTG1)   Chromatin remodeling factors    BAF complex     136138031 (ACTG1)    PBAF complex     136138031 (ACTG1)    GBAF(ncBAF) complex     136138031 (ACTG1)    SWR1 complex     136138031 (ACTG1) Mitochondrial biogenesis [BR:pphc03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     136138031 (ACTG1) Cytoskeleton proteins [BR:pphc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      136138031 (ACTG1) Exosome [BR:pphc04147]  Exosomal proteins   Proteins found in most exosomes    136138031 (ACTG1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  136138031 NCBI-ProteinID:  XP_065752609 LinkDB All DBs Position 19:complement(11773972..11776825) Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaagaaatcgccgcgctcgtcatcgataatggctctggcatgtgcaaagcgggc tttgctggggatgacgctccccgggccgtgttcccgtccatcgttgggcgtccccgacac cagggcgtcatggtgggcatggggcagaaggacagctacgtgggcgacgaggcccagagc aagcgtggcatcctgactctcaagtaccccattgagcacggcattgtcaccaattgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccccgaggag caccctgtgctgctgacggaggcccccctgaaccccaaggccaaccgtgagaagatgacc cagatcatgttcgagactttcaacactccggccatgtacgtggccatccaggctgtgctg tccctgtacgcttctggccgcaccactggtatagtcatggactctggggatggggtcacc cacacggtgcccatctacgaggggtacgccctcccccacgccatcctgcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctcacggagcgtggctacagcttc accaccacagctgagcgggaaatcgtgcgtgacatcaaggagaagctctgctacgttgcc ctggacttcgagcaggagatggccaccgccgcgtcctcctcctccttggagaagagctac gagctgcctgatggtcaggtgatcaccatcggcaacgagcggttccggtgtccagaggcg ctcttccagccctccttcttgggtatggaatcctgtggcatccacgagactaccttcaac tctatcatgaagtgtgatgtcgacatccggaaggacctgtatgccaacacggtgctgtct ggtgggaccaccatgtatcccggcatcgccgacaggatgcagaaggagatcacggctctg gcccccagcacaatgaagatcaagatcatcgctcctcccgagcgcaagtactcggtgtgg atcgggggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtacgacgagtcgggcccctccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system