Phoxinus phoxinus (Eurasian minnow): 306991098 Help Entry 306991098         CDS       T12064                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism pphx  Phoxinus phoxinus (Eurasian minnow) Pathway pphx03030   DNA replication pphx03410   Base excision repair pphx03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pphx00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     306991098 (pole4)    03410 Base excision repair     306991098 (pole4)    03420 Nucleotide excision repair     306991098 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pphx03032]     306991098 (pole4)    03400 DNA repair and recombination proteins [BR:pphx03400]     306991098 (pole4) Enzymes [BR:pphx01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      306991098 (pole4) DNA replication proteins [BR:pphx03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     306991098 (pole4) DNA repair and recombination proteins [BR:pphx03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       306991098 (pole4) SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  306991098 NCBI-ProteinID:  XP_079454745 LinkDB All DBs Position 22:complement(7301789..7309555) Genome browser AA seq 127 aa AA seqDB search MAATVSAAPVESDLDRSGTEDEPRGTEAEEDGGNGQTGPTAGAQQNRLAKLPLSRIKTLM KADPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDEFA FLEGTLD NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggcggcgactgtgtcagcagctcccgtggagtcggatttggaccgcagcggaactgaa gacgagccccggggaaccgaggcggaggaggacggagggaatgggcaaactgggcccacc gcgggcgcgcagcagaaccgcctcgccaagttaccgctgtcccgcatcaaaacactgatg aaagcagatccggatgtgagtctggcgagtcaagagtccgtgttcatcatagctaaagcc acggagctttttgttgaaatgattgcaaaggacgcccttgtttatgcccaacagggaaag agaaaaactcttcaacgcaaagacttggataatgctattgaagcaatagatgaatttgcg tttttggaaggtaccctggactga

DBGET integrated database retrieval system