Pleuronectes platessa (European plaice): 128449164 Help Entry 128449164         CDS       T09923                                  Name (RefSeq) beta-2-microglobulin   KO K06752   MHC class II antigen Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt04145   Phagosome pplt04514   Cell adhesion molecules pplt04672   Intestinal immune network for IgA production pplt05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pplt00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     128449164  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     128449164  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     128449164  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     128449164  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pplt04147]     128449164 Exosome [BR:pplt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128449164   Exosomal proteins of epithelial cells    128449164   Exosomal proteins of breast milk    128449164 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  C1-set C2-set_2 Ig_3 C2-set_3 MHC_II_beta Motif Other DBs NCBI-GeneID:  128449164 NCBI-ProteinID:  XP_053288188 LinkDB All DBs Position 10:complement(3414789..3415949) Genome browser AA seq 137 aa AA seqDB search MKLSTLYDSRVGKYVGFGEFGMKNAKHYNTQEWKMALMKSSMPPVVRVHHTDPADYGVRT ILHCSVLGFYPQKVQVSWLRDGVDVSRDVSSTDVLANEDWSFQVHSYLELTPRRGERVSC RVEHSSLSQSLEVDWGP NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgaagctcagcaccttgtacgactcccgggtcgggaagtacgtgggctttggagaattt ggcatgaaaaacgcaaaacattacaacactcaggaatggaaaatggccttgatgaagagt tcaatgccgccggttgtcagggtccatcacaccgatccggctgactacggggtgcggacc atcctccactgcagcgtcttgggcttctaccctcagaaagtgcaggtgagctggctgagg gacggggtggacgtctccagggacgtatcgtccactgacgtcctggccaacgaggactgg agcttccaggtccactcctacctggagctgacgcccaggaggggggagagggtgagctgc agggtggagcacagcagtctgtcacagagcctagaggtggactggggtccgtga

DBGET integrated database retrieval system