Papilio polytes (common Mormon): 106100422 Help Entry 106100422         CDS       T07437                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ppot  Papilio polytes (common Mormon) Pathway ppot03420   Nucleotide excision repair ppot04120   Ubiquitin mediated proteolysis ppot04141   Protein processing in endoplasmic reticulum ppot04310   Wnt signaling pathway ppot04341   Hedgehog signaling pathway - fly ppot04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:ppot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106100422    04120 Ubiquitin mediated proteolysis     106100422   09124 Replication and repair    03420 Nucleotide excision repair     106100422  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     106100422    04341 Hedgehog signaling pathway - fly     106100422    04350 TGF-beta signaling pathway     106100422  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ppot04121]     106100422    03400 DNA repair and recombination proteins [BR:ppot03400]     106100422 Enzymes [BR:ppot01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      106100422 Ubiquitin system [BR:ppot04121]  Ubiquitin ligases (E3)   UBL E3 ligases    106100422   Multi subunit type E3    SCF complex     Ring finger protein      106100422    Cul2 complex      106100422    Cul3 complex      106100422    Cul4 complex      106100422    Cul7 complex      106100422    Cul8 complex      106100422    Cul9 complex      106100422 DNA repair and recombination proteins [BR:ppot03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       106100422     TCR (transcription coupled repair) factors      Cul4-CSA complex       106100422 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  106100422 NCBI-ProteinID:  XP_013134717 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MASAMDIDEDEVEMASSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcatccgcaatggatattgacgaagacgaagtcgaaatggcttcttcaagcagtagc aaaggagacaagaaaagatttgaagtaaaaaagtggaacgccgttgctttgtgggcttgg gatattgtggtggacaactgcgcaatctgtcgtaaccacataatggatctttgcatagaa tgccaagcgaatcaagcatctgctaccagtgaagaatgcacagttgcttggggagtttgt aatcatgcattccacttccattgtatttcacgttggctcaaaactcgacaagtgtgtcca ttagacaacagagaatgggagttccaaaagtatggccactaa

DBGET integrated database retrieval system