Papilio polytes (common Mormon): 106102745 Help Entry 106102745         CDS       T07437                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ppot  Papilio polytes (common Mormon) Pathway ppot00510   N-Glycan biosynthesis ppot00513   Various types of N-glycan biosynthesis ppot04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ppot00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     106102745    00513 Various types of N-glycan biosynthesis     106102745  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106102745 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Pox_E2-like Pestivirus_E2 Motif Other DBs NCBI-GeneID:  106102745 NCBI-ProteinID:  XP_013137767 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search MTLEIESMVRYTSPINPGVFPHLTILLLGIGIFFMAWFFVYEVTSTKSTRDLFKELLLSL VASLFSGFGVLFLLLWVGIYV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccttggaaatagagtcaatggtacgatacacgtcgccgataaacccgggcgtgttt ccacacctcactatattattgctcggtatcggcattttcttcatggcatggttcttcgta tatgaagtaacaagcaccaaatcaaccagagatctcttcaaggaactcttgctgtcactc gtcgcgtctttattttccggcttcggtgtgctgtttctcctgttatgggttggcatttac gtgtga

DBGET integrated database retrieval system