Pseudodesulfovibrio profundus: DPRO_2685 Help Entry DPRO_2685         CDS       T05258                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism pprf  Pseudodesulfovibrio profundus Pathway pprf01100   Metabolic pathways pprf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pprf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DPRO_2685 (acpP)    00074 Mycolic acid biosynthesis     DPRO_2685 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DPRO_2685 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  SOB59594 UniProt:  A0A2C8FAY0 LinkDB All DBs Position DPRO:2766385..2766618 Genome browser AA seq 77 aa AA seqDB search MSDVAAKVKDIIVEQLGVSEDEVVNSAAFVEDLGADSLDLTELIMAMEEEFDLEIDDEVA QKIVKVEDAISHIEKAI NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtccgatgtcgcagcaaaagtaaaagatatcatcgttgagcagcttggtgtttccgaa gacgaagtcgttaactccgcagctttcgttgaagatctgggcgctgattctctggacctg accgaactgatcatggccatggaagaagaattcgacctggaaatcgacgacgaagtagct cagaagatcgtcaaggtcgaagatgccatttcccacatcgaaaaggccatctaa

DBGET integrated database retrieval system