KEGG   Pseudodesulfovibrio profundus: DPRO_3979
Entry
DPRO_3979         CDS       T05258                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal subunit protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
pprf  Pseudodesulfovibrio profundus
Pathway
pprf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pprf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DPRO_3979 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pprf03011]
    DPRO_3979 (rplR)
Ribosome [BR:pprf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DPRO_3979 (rplR)
  Bacteria
    DPRO_3979 (rplR)
  Archaea
    DPRO_3979 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-ProteinID: SOB60898
UniProt: A0A2C8FEL9
LinkDB
Position
DPRO:4124651..4125010
AA seq 119 aa
MSKSKNAKRLTRKPRIRKKVSGTEARPRLVVFRSNQHLYAQLVDDVNGVTLASSSTQVLA
KEGESLKANKESAAKVGKDIAAKALENKIETVVFDRNGYIYHGKIKSLADGAREGGLKF
NT seq 360 nt   +upstreamnt  +downstreamnt
atgagtaaaagcaagaatgcaaagcggcttactcgtaagccccgcatcagaaaaaaggtc
tccggtactgaagcacgaccccgtttggttgtcttccgctccaaccagcatctttatgct
cagttggttgacgatgtaaacggtgtgactctcgcttcttccagcactcaggtgttggct
aaggaaggcgagtctctgaaagccaacaaagaatccgcagccaaagtcggtaaagacatt
gctgcgaaggctttggagaacaagatcgaaaccgtcgtctttgaccggaatggttatatc
tatcacggcaagattaaatcccttgccgacggtgcccgcgagggcgggctgaaattctag

DBGET integrated database retrieval system