Pimephales promelas (fathead minnow): 120462132 Help Entry 120462132         CDS       T08155                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm03420   Nucleotide excision repair pprm04110   Cell cycle pprm04114   Oocyte meiosis pprm04120   Ubiquitin mediated proteolysis pprm04141   Protein processing in endoplasmic reticulum pprm04310   Wnt signaling pathway pprm04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:pprm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120462132 (rbx1)    04120 Ubiquitin mediated proteolysis     120462132 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     120462132 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     120462132 (rbx1)    04350 TGF-beta signaling pathway     120462132 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     120462132 (rbx1)    04114 Oocyte meiosis     120462132 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pprm04121]     120462132 (rbx1)    03400 DNA repair and recombination proteins [BR:pprm03400]     120462132 (rbx1) Enzymes [BR:pprm01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120462132 (rbx1) Ubiquitin system [BR:pprm04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120462132 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      120462132 (rbx1)    Cul2 complex      120462132 (rbx1)    Cul3 complex      120462132 (rbx1)    Cul4 complex      120462132 (rbx1)    Cul7 complex      120462132 (rbx1)    Cul8 complex      120462132 (rbx1)    Cul9 complex      120462132 (rbx1) DNA repair and recombination proteins [BR:pprm03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120462132 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       120462132 (rbx1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  120462132 NCBI-ProteinID:  XP_039506565 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGANSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggctgcgatggatgtggacaccccgagtggagctaacagtggagccagtaagaag cgttttgaagtgaaaaagtggaatgcagtggctctgtgggcttgggacattgtggtggac aactgtgccatttgtagaaatcacattatggacctctgtatagagtgtcaggccaatcag gcatcagctacatcagaggagtgcacagtggcctggggtgtctgcaatcatgcgtttcat ttccactgtatctctcgctggctgaagaccagacaggtgtgtcccctggacaacagagag tgggagtttcagaagtatggccattag

DBGET integrated database retrieval system