Pimephales promelas (fathead minnow): 120471776 Help Entry 120471776         CDS       T08155                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm00510   N-Glycan biosynthesis pprm00513   Various types of N-glycan biosynthesis pprm04141   Protein processing in endoplasmic reticulum Module pprm_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:pprm00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     120471776 (tmem258)    00513 Various types of N-glycan biosynthesis     120471776 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120471776 (tmem258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB DUF7318 Motif Other DBs NCBI-GeneID:  120471776 NCBI-ProteinID:  XP_039517619 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTIVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIFV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagttggaagccatgacgagatacaccagcccggtgaacccggccgtgttcccccac ctcaccatagtgctgctggccatcggcatgttcttcacggcctggttctttgtatatgaa gtaacgtccaccaagtacacgagagacgtgtacaaagagctgctgatctctctggtggcg tcgctcttcatgggcttcggcgttctcttcctcttactctgggtcggcatttttgtctga

DBGET integrated database retrieval system