Pimephales promelas (fathead minnow): 120476984 Help Entry 120476984         CDS       T08155                                  Symbol rap1b Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm04010   MAPK signaling pathway pprm04510   Focal adhesion pprm04517   IgSF CAM signaling pprm04520   Adherens junction Brite KEGG Orthology (KO) [BR:pprm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120476984 (rap1b)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     120476984 (rap1b)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     120476984 (rap1b)    04520 Adherens junction     120476984 (rap1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pprm04147]     120476984 (rap1b)    04031 GTP-binding proteins [BR:pprm04031]     120476984 (rap1b) Exosome [BR:pprm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120476984 (rap1b)   Exosomal proteins of other body fluids (saliva and urine)    120476984 (rap1b)   Exosomal proteins of colorectal cancer cells    120476984 (rap1b) GTP-binding proteins [BR:pprm04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     120476984 (rap1b) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  120476984 NCBI-ProteinID:  XP_039524250 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNSCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatacaagttagtagtccttggatcaggaggtgtcggcaagtctgcgctgact gttcaatttgtccaagggatctttgtggaaaagtatgaccccacaatagaagactcatac agaaagcaagtggaggtggatggacagcagtgtatgttggaaattctggatactgccgga acggaacaattcacagccatgagggacctgtacatgaagaacggccagggctttgcacta gtatactccataacagcacagtccaccttcaacgacctgcaggacttgagagaacagatt ctgcgggtcaaagacaccgatgatgtgccgatgatcctggtgggtaataagtgtgatctg gaagacgagagggtggtcgggaaagaacagggccagaatctcgcccgccagtggaacagc tgtgctttcctggagtcctctgcaaagtccaagattaacgtcaacgagatcttctatgac ctggttcggcaaatcaacaggaaaactccagtacctgggaaggcacgcaaaaagtccacc tgccaactgctctaa

DBGET integrated database retrieval system