KEGG   Paroceanicella profunda: FDP22_01630
Entry
FDP22_01630       CDS       T06319                                 
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
ppru  Paroceanicella profunda
Pathway
ppru03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ppru00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FDP22_01630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ppru03011]
    FDP22_01630
Ribosome [BR:ppru03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FDP22_01630
  Bacteria
    FDP22_01630
  Archaea
    FDP22_01630
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-ProteinID: QDL90599
UniProt: A0A5B8FVT3
LinkDB
Position
complement(377981..378340)
AA seq 119 aa
MAMSKLALFQKRRMRVRSRLAKVSGGKPRLSVHRSSKNISVQVIDDAQGRTLAAASTLEA
GFGLAGKNNVEAAAKIGSAIAERAKAAGVEEVVFDRGGYLFHGKVKALADAAREGGLKF
NT seq 360 nt   +upstreamnt  +downstreamnt
atggctatgagcaaacttgcgctgttccagaaacgccgtatgcgcgtgcggagcaggctc
gcgaaggtcagtggcggcaagccccggctgagcgtccaccggtcctcgaagaacatctcg
gtccaggtgatcgacgacgcgcagggtcggaccctcgccgcggcgtcgacgctggaggcc
gggttcggtctcgcgggcaagaacaacgtcgaggctgccgcgaagatcggctccgcgatt
gccgagcgcgcgaaagccgccggtgtcgaggaagtcgtgttcgatcgtggcggctacctt
ttccacggcaaggtgaaagcccttgcggatgccgcccgtgagggcggtctcaagttctga

DBGET integrated database retrieval system