Pan paniscus (bonobo): 100970542 Help Entry 100970542         CDS       T02283                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism pps  Pan paniscus (bonobo) Pathway pps03082   ATP-dependent chromatin remodeling pps04015   Rap1 signaling pathway pps04145   Phagosome pps04210   Apoptosis pps04390   Hippo signaling pathway pps04510   Focal adhesion pps04520   Adherens junction pps04530   Tight junction pps04611   Platelet activation pps04613   Neutrophil extracellular trap formation pps04670   Leukocyte transendothelial migration pps04714   Thermogenesis pps04810   Regulation of actin cytoskeleton pps04814   Motor proteins pps04820   Cytoskeleton in muscle cells pps04919   Thyroid hormone signaling pathway pps04921   Oxytocin signaling pathway pps04971   Gastric acid secretion pps05014   Amyotrophic lateral sclerosis pps05100   Bacterial invasion of epithelial cells pps05132   Salmonella infection pps05135   Yersinia infection pps05164   Influenza A pps05205   Proteoglycans in cancer pps05225   Hepatocellular carcinoma pps05410   Hypertrophic cardiomyopathy pps05412   Arrhythmogenic right ventricular cardiomyopathy pps05414   Dilated cardiomyopathy pps05416   Viral myocarditis pps05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100970542 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100970542 (ACTG1)    04390 Hippo signaling pathway     100970542 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100970542 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     100970542 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100970542 (ACTG1)    04520 Adherens junction     100970542 (ACTG1)    04530 Tight junction     100970542 (ACTG1)   09142 Cell motility    04814 Motor proteins     100970542 (ACTG1)    04820 Cytoskeleton in muscle cells     100970542 (ACTG1)    04810 Regulation of actin cytoskeleton     100970542 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100970542 (ACTG1)    04613 Neutrophil extracellular trap formation     100970542 (ACTG1)    04670 Leukocyte transendothelial migration     100970542 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     100970542 (ACTG1)    04919 Thyroid hormone signaling pathway     100970542 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     100970542 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     100970542 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100970542 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100970542 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     100970542 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     100970542 (ACTG1)    05135 Yersinia infection     100970542 (ACTG1)    05100 Bacterial invasion of epithelial cells     100970542 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100970542 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100970542 (ACTG1)    05410 Hypertrophic cardiomyopathy     100970542 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     100970542 (ACTG1)    05414 Dilated cardiomyopathy     100970542 (ACTG1)    05416 Viral myocarditis     100970542 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pps03021]     100970542 (ACTG1)    03019 Messenger RNA biogenesis [BR:pps03019]     100970542 (ACTG1)    03036 Chromosome and associated proteins [BR:pps03036]     100970542 (ACTG1)    03029 Mitochondrial biogenesis [BR:pps03029]     100970542 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pps04812]     100970542 (ACTG1)    04147 Exosome [BR:pps04147]     100970542 (ACTG1) Transcription machinery [BR:pps03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100970542 (ACTG1) Messenger RNA biogenesis [BR:pps03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100970542 (ACTG1) Chromosome and associated proteins [BR:pps03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100970542 (ACTG1)     NuA4 complex      100970542 (ACTG1)   Chromatin remodeling factors    BAF complex     100970542 (ACTG1)    PBAF complex     100970542 (ACTG1)    GBAF(ncBAF) complex     100970542 (ACTG1)    SWR1 complex     100970542 (ACTG1) Mitochondrial biogenesis [BR:pps03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100970542 (ACTG1) Cytoskeleton proteins [BR:pps04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100970542 (ACTG1) Exosome [BR:pps04147]  Exosomal proteins   Proteins found in most exosomes    100970542 (ACTG1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100970542 NCBI-ProteinID:  XP_003831173 Ensembl:  ENSPPAG00000037318 UniProt:  A0A2R9BH44 LinkDB All DBs Position 19:complement(98096764..98099674) Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaagagatcgccgcgctggtcattgacaatggctccggcatgtgcaaagctggt tttgctggggacgacgctccccgagccgtgtttccttccatcgtcgggcgacccagacac cagggcgtgatggtgggcatgggccagaaggactcctacgtgggcgacgaggcccagagc aagcgtggcatcctgaccctgaagtaccccattgagcatggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggccccggaggag cacccagtgctgctgaccgaggcccccctgaaccccaaggccaacagagagaagatgact cagattatgtttgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg tccctctacgcctctgggcgcaccactggcattgtcatggactctggagacggggtcacc cacacggtgcccatctacgagggctacgccctcccccacgccatcctgcgtctggacctg gctggccgggacctgaccgactacctcatgaagatcctcaccgagcgaggctacagcttc accaccacggccgagcgggaaatcgtgcgcgacatcaaggagaagctgtgctacgtcgcc ctggacttcgagcaggagatggccaccgccgcatcctcttcttctctggagaagagctac gagctgcccgatggccaggtcatcaccatcggcaatgagcggttccggtgtccggaggcg ctgttccagccttccttcctgggcatggaatcttgcggcatccacgagaccaccttcaac tccatcatgaagtgtgacgtggacatccgcaaagacctgtatgccaacacggtgctgtcg ggcggcaccaccatgtacccaggcatcgccgacaggatgcagaaggagatcaccgccctg gcgcccagcaccatgaagatcaagatcatcgcacccccagagcgcaagtactcggtgtgg atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggattagcaagcag gagtacgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system