Pan paniscus (bonobo): 100976904 Help Entry 100976904         CDS       T02283                                  Name (RefSeq) growth-regulated alpha protein   KO K05505   C-X-C motif chemokine 1/2/3 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04062   Chemokine signaling pathway pps04064   NF-kappa B signaling pathway pps04621   NOD-like receptor signaling pathway pps04657   IL-17 signaling pathway pps04668   TNF signaling pathway pps04936   Alcoholic liver disease pps05134   Legionellosis pps05146   Amoebiasis pps05167   Kaposi sarcoma-associated herpesvirus infection pps05323   Rheumatoid arthritis pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100976904    04668 TNF signaling pathway     100976904   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100976904    04061 Viral protein interaction with cytokine and cytokine receptor     100976904  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100976904    04657 IL-17 signaling pathway     100976904    04062 Chemokine signaling pathway     100976904  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     100976904   09171 Infectious disease: bacterial    05134 Legionellosis     100976904   09174 Infectious disease: parasitic    05146 Amoebiasis     100976904   09163 Immune disease    05323 Rheumatoid arthritis     100976904   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100976904   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100976904  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100976904 Cytokines and neuropeptides [BR:pps04052]  Cytokines   Chemokines    100976904 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100976904 NCBI-ProteinID:  XP_003832380 Ensembl:  ENSPPAG00000030606 UniProt:  A0A2R9AI50 LinkDB All DBs Position 3:complement(56193010..56195078) Genome browser AA seq 107 aa AA seqDB search MARAALSAAPSSPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSL NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccgctctctccgccgcccccagcagtccccggctcctgcgagtggcactg ctgctcctgctcctggtagccgccggccggcgcgcagcaggagcgtccgtggccactgaa ctgcgctgccagtgcttgcagaccctgcagggaattcaccccaagaacatccaaagtctg aacgtgaagtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat gggcggaaagcttgccttaatcccgcatcccccatagttaagaaaatcatcgaaaagatg ctgaacagtgacaaatccaactga

DBGET integrated database retrieval system