Pan paniscus (bonobo): 100977674 Help Entry 100977674         CDS       T02283                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism pps  Pan paniscus (bonobo) Pathway pps01523   Antifolate resistance pps04010   MAPK signaling pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04064   NF-kappa B signaling pathway pps04071   Sphingolipid signaling pathway pps04150   mTOR signaling pathway pps04210   Apoptosis pps04217   Necroptosis pps04350   TGF-beta signaling pathway pps04380   Osteoclast differentiation pps04612   Antigen processing and presentation pps04620   Toll-like receptor signaling pathway pps04621   NOD-like receptor signaling pathway pps04622   RIG-I-like receptor signaling pathway pps04625   C-type lectin receptor signaling pathway pps04640   Hematopoietic cell lineage pps04650   Natural killer cell mediated cytotoxicity pps04657   IL-17 signaling pathway pps04660   T cell receptor signaling pathway pps04664   Fc epsilon RI signaling pathway pps04668   TNF signaling pathway pps04920   Adipocytokine signaling pathway pps04930   Type II diabetes mellitus pps04931   Insulin resistance pps04932   Non-alcoholic fatty liver disease pps04933   AGE-RAGE signaling pathway in diabetic complications pps04936   Alcoholic liver disease pps04940   Type I diabetes mellitus pps05010   Alzheimer disease pps05014   Amyotrophic lateral sclerosis pps05020   Prion disease pps05022   Pathways of neurodegeneration - multiple diseases pps05132   Salmonella infection pps05133   Pertussis pps05134   Legionellosis pps05135   Yersinia infection pps05140   Leishmaniasis pps05142   Chagas disease pps05143   African trypanosomiasis pps05144   Malaria pps05145   Toxoplasmosis pps05146   Amoebiasis pps05152   Tuberculosis pps05160   Hepatitis C pps05161   Hepatitis B pps05163   Human cytomegalovirus infection pps05164   Influenza A pps05165   Human papillomavirus infection pps05166   Human T-cell leukemia virus 1 infection pps05168   Herpes simplex virus 1 infection pps05169   Epstein-Barr virus infection pps05170   Human immunodeficiency virus 1 infection pps05171   Coronavirus disease - COVID-19 pps05205   Proteoglycans in cancer pps05310   Asthma pps05321   Inflammatory bowel disease pps05322   Systemic lupus erythematosus pps05323   Rheumatoid arthritis pps05330   Allograft rejection pps05332   Graft-versus-host disease pps05410   Hypertrophic cardiomyopathy pps05414   Dilated cardiomyopathy pps05417   Lipid and atherosclerosis pps05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100977674 (TNF)    04350 TGF-beta signaling pathway     100977674 (TNF)    04064 NF-kappa B signaling pathway     100977674 (TNF)    04668 TNF signaling pathway     100977674 (TNF)    04071 Sphingolipid signaling pathway     100977674 (TNF)    04150 mTOR signaling pathway     100977674 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100977674 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     100977674 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100977674 (TNF)    04217 Necroptosis     100977674 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100977674 (TNF)    04620 Toll-like receptor signaling pathway     100977674 (TNF)    04621 NOD-like receptor signaling pathway     100977674 (TNF)    04622 RIG-I-like receptor signaling pathway     100977674 (TNF)    04625 C-type lectin receptor signaling pathway     100977674 (TNF)    04650 Natural killer cell mediated cytotoxicity     100977674 (TNF)    04612 Antigen processing and presentation     100977674 (TNF)    04660 T cell receptor signaling pathway     100977674 (TNF)    04657 IL-17 signaling pathway     100977674 (TNF)    04664 Fc epsilon RI signaling pathway     100977674 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100977674 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     100977674 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100977674 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100977674 (TNF)    05170 Human immunodeficiency virus 1 infection     100977674 (TNF)    05161 Hepatitis B     100977674 (TNF)    05160 Hepatitis C     100977674 (TNF)    05171 Coronavirus disease - COVID-19     100977674 (TNF)    05164 Influenza A     100977674 (TNF)    05168 Herpes simplex virus 1 infection     100977674 (TNF)    05163 Human cytomegalovirus infection     100977674 (TNF)    05169 Epstein-Barr virus infection     100977674 (TNF)    05165 Human papillomavirus infection     100977674 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     100977674 (TNF)    05135 Yersinia infection     100977674 (TNF)    05133 Pertussis     100977674 (TNF)    05134 Legionellosis     100977674 (TNF)    05152 Tuberculosis     100977674 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     100977674 (TNF)    05144 Malaria     100977674 (TNF)    05145 Toxoplasmosis     100977674 (TNF)    05140 Leishmaniasis     100977674 (TNF)    05142 Chagas disease     100977674 (TNF)    05143 African trypanosomiasis     100977674 (TNF)   09163 Immune disease    05310 Asthma     100977674 (TNF)    05322 Systemic lupus erythematosus     100977674 (TNF)    05323 Rheumatoid arthritis     100977674 (TNF)    05321 Inflammatory bowel disease     100977674 (TNF)    05330 Allograft rejection     100977674 (TNF)    05332 Graft-versus-host disease     100977674 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     100977674 (TNF)    05014 Amyotrophic lateral sclerosis     100977674 (TNF)    05020 Prion disease     100977674 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     100977674 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100977674 (TNF)    05418 Fluid shear stress and atherosclerosis     100977674 (TNF)    05410 Hypertrophic cardiomyopathy     100977674 (TNF)    05414 Dilated cardiomyopathy     100977674 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100977674 (TNF)    04940 Type I diabetes mellitus     100977674 (TNF)    04936 Alcoholic liver disease     100977674 (TNF)    04932 Non-alcoholic fatty liver disease     100977674 (TNF)    04931 Insulin resistance     100977674 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     100977674 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100977674 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100977674 (TNF)    00536 Glycosaminoglycan binding proteins [BR:pps00536]     100977674 (TNF) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Tumor necrosis fators    100977674 (TNF) Glycosaminoglycan binding proteins [BR:pps00536]  Heparan sulfate / Heparin   Cytokines    100977674 (TNF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  100977674 NCBI-ProteinID:  XP_003831637 Ensembl:  ENSPPAG00000017754 UniProt:  A0A2R8ZGR1 LinkDB All DBs Position 5:46052507..46055280 Genome browser AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag acaggggggccccagggctccaggcggtgcttgttcctcagcctcttctccttcctgatc gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg gaagagttccccagggacctctctctaatcagccctctggcccaggcagtcagatcatct tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaga gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc aagggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgcc gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag accccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttc cagctggagaagggtgaccgactcagcgctgagatcaatcggcccgactatctcgacttt gccgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system