Pan paniscus (bonobo): 100987964 Help Entry 100987964         CDS       T02283                                  Name (RefSeq) LOW QUALITY PROTEIN: actin-like   KO K05692   actin beta/gamma 1 Organism pps  Pan paniscus (bonobo) Pathway pps03082   ATP-dependent chromatin remodeling pps04015   Rap1 signaling pathway pps04145   Phagosome pps04210   Apoptosis pps04390   Hippo signaling pathway pps04510   Focal adhesion pps04517   IgSF CAM signaling pps04518   Integrin signaling pps04519   Cadherin signaling pps04520   Adherens junction pps04530   Tight junction pps04611   Platelet activation pps04613   Neutrophil extracellular trap formation pps04670   Leukocyte transendothelial migration pps04714   Thermogenesis pps04810   Regulation of actin cytoskeleton pps04814   Motor proteins pps04820   Cytoskeleton in muscle cells pps04919   Thyroid hormone signaling pathway pps04921   Oxytocin signaling pathway pps04971   Gastric acid secretion pps05014   Amyotrophic lateral sclerosis pps05100   Bacterial invasion of epithelial cells pps05132   Salmonella infection pps05135   Yersinia infection pps05164   Influenza A pps05205   Proteoglycans in cancer pps05225   Hepatocellular carcinoma pps05410   Hypertrophic cardiomyopathy pps05412   Arrhythmogenic right ventricular cardiomyopathy pps05414   Dilated cardiomyopathy pps05416   Viral myocarditis pps05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100987964  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100987964    04390 Hippo signaling pathway     100987964   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100987964    04518 Integrin signaling     100987964    04519 Cadherin signaling     100987964  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100987964   09143 Cell growth and death    04210 Apoptosis     100987964   09144 Cellular community - eukaryotes    04510 Focal adhesion     100987964    04520 Adherens junction     100987964    04530 Tight junction     100987964   09142 Cell motility    04814 Motor proteins     100987964    04820 Cytoskeleton in muscle cells     100987964    04810 Regulation of actin cytoskeleton     100987964  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100987964    04613 Neutrophil extracellular trap formation     100987964    04670 Leukocyte transendothelial migration     100987964   09152 Endocrine system    04921 Oxytocin signaling pathway     100987964    04919 Thyroid hormone signaling pathway     100987964   09154 Digestive system    04971 Gastric acid secretion     100987964   09159 Environmental adaptation    04714 Thermogenesis     100987964  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100987964   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100987964   09172 Infectious disease: viral    05164 Influenza A     100987964   09171 Infectious disease: bacterial    05132 Salmonella infection     100987964    05135 Yersinia infection     100987964    05100 Bacterial invasion of epithelial cells     100987964   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100987964   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100987964    05410 Hypertrophic cardiomyopathy     100987964    05412 Arrhythmogenic right ventricular cardiomyopathy     100987964    05414 Dilated cardiomyopathy     100987964    05416 Viral myocarditis     100987964  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pps03021]     100987964    03019 Messenger RNA biogenesis [BR:pps03019]     100987964    03036 Chromosome and associated proteins [BR:pps03036]     100987964    03029 Mitochondrial biogenesis [BR:pps03029]     100987964   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pps04812]     100987964    04147 Exosome [BR:pps04147]     100987964 Transcription machinery [BR:pps03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100987964 Messenger RNA biogenesis [BR:pps03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100987964 Chromosome and associated proteins [BR:pps03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100987964     NuA4 complex      100987964   Chromatin remodeling factors    BAF complex     100987964    PBAF complex     100987964    GBAF(ncBAF) complex     100987964    SWR1 complex     100987964 Mitochondrial biogenesis [BR:pps03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100987964 Cytoskeleton proteins [BR:pps04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100987964 Exosome [BR:pps04147]  Exosomal proteins   Proteins found in most exosomes    100987964 SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100987964 NCBI-ProteinID:  XP_014198879 LinkDB All DBs Position 1:complement(11233646..11234364) Genome browser AA seq 239 aa AA seqDB search MEEEIATLAIDNGSSMCKAGFAGDDAPQAVFPSIIGHPRHKSVMVGMGQKDSYVGDKAQS KXGILTLKYPIEHGIVTNWDDMEKMWDHTFYNELCVALEEHPVLLIEACPNPKANREKMT QIMFETFNTPAMYVAIQPVLSLYASGRTSGIVRDSGDGVTHTVPIYVGYALPHAILHLDL AGRDLTGYLMKILTERGYSFTTSAQREIMPHIREKLCYITLDFEKEMATAASSSSLEKS NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atggaagaagagatcgccacgcttgccattgacaatggctccagcatgtgcaaagctggc tttgctggggacgatgccccccaagctgtgtttccctccatcatcgggcacccccggcat aagagcgtgatggtgggcatgggccagaaggactcctacgtgggcgacaaggcccagagc aagnccggcatcctgaccctgaagtaccccattgagcatggcatcgtcaccaactgggac gacatggagaagatgtgggaccacaccttctacaatgagctgtgcgtggccctggaggag cacccagtgctgctgatcgaggcctgcccgaaccccaaggccaacagagagaagatgact cagatcatgtttgagaccttcaacaccccggccatgtatgtggccatccagcccgtgcta tccctctacgcctctgggcgcaccagtggcattgtcagggactctggagatggggtcacc cacacggtgcccatctacgtgggctacgccctcccacatgccatcctgcatctggacctg gctggcagggacctgacaggctacctcatgaagatcctcaccgagcgtggctacagcttc accacctcggcccagcgggagatcatgccccacatcagggagaagctgtgctacatcacc ctggacttcgagaaggagatggccacggccgcatcttcctcctccctggagaagagctag

DBGET integrated database retrieval system