Pan paniscus (bonobo): 100990760 Help Entry 100990760         CDS       T02283                                  Symbol IL10 Name (RefSeq) interleukin-10 isoform X1   KO K05443   interleukin 10 Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04061   Viral protein interaction with cytokine and cytokine receptor pps04068   FoxO signaling pathway pps04148   Efferocytosis pps04625   C-type lectin receptor signaling pathway pps04630   JAK-STAT signaling pathway pps04660   T cell receptor signaling pathway pps04672   Intestinal immune network for IgA production pps05133   Pertussis pps05135   Yersinia infection pps05140   Leishmaniasis pps05142   Chagas disease pps05143   African trypanosomiasis pps05144   Malaria pps05145   Toxoplasmosis pps05146   Amoebiasis pps05150   Staphylococcus aureus infection pps05152   Tuberculosis pps05310   Asthma pps05320   Autoimmune thyroid disease pps05321   Inflammatory bowel disease pps05322   Systemic lupus erythematosus pps05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100990760 (IL10)    04068 FoxO signaling pathway     100990760 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100990760 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     100990760 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100990760 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100990760 (IL10)    04660 T cell receptor signaling pathway     100990760 (IL10)    04672 Intestinal immune network for IgA production     100990760 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     100990760 (IL10)    05133 Pertussis     100990760 (IL10)    05150 Staphylococcus aureus infection     100990760 (IL10)    05152 Tuberculosis     100990760 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     100990760 (IL10)    05144 Malaria     100990760 (IL10)    05145 Toxoplasmosis     100990760 (IL10)    05140 Leishmaniasis     100990760 (IL10)    05142 Chagas disease     100990760 (IL10)    05143 African trypanosomiasis     100990760 (IL10)   09163 Immune disease    05310 Asthma     100990760 (IL10)    05322 Systemic lupus erythematosus     100990760 (IL10)    05320 Autoimmune thyroid disease     100990760 (IL10)    05321 Inflammatory bowel disease     100990760 (IL10)    05330 Allograft rejection     100990760 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100990760 (IL10)    00536 Glycosaminoglycan binding proteins [BR:pps00536]     100990760 (IL10) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Interleukins    100990760 (IL10) Glycosaminoglycan binding proteins [BR:pps00536]  Heparan sulfate / Heparin   Cytokines    100990760 (IL10) SSDB OrthologParalogGFIT Motif Pfam:  IL10 IL22 Tyr_recomb_halo_N Motif Other DBs NCBI-GeneID:  100990760 NCBI-ProteinID:  XP_003822966 Ensembl:  ENSPPAG00000008601 UniProt:  A0A2R8ZE59 LinkDB All DBs Position 1:42602021..42609622 Genome browser AA seq 178 aa AA seqDB search MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKVHVNSLGENLKTLR LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcacagctcagcactgctctgttgcctggtcctcctgactggggtgagggccagccca ggccagggcacccagtctgagaacagctgcacccacttcccaggcaacctgcctaacatg cttcgagatctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag ctggacaacttgttgttaaaggagtccttgctggaggactttaagggttacctgggttgc caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac caagacccagacatcaaggtgcatgtgaactccctgggggagaacctgaagaccctcagg ctgaggctacggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggccgtggag caggtgaagaatgcctttaataagctccaagagaaaggcatctacaaagccatgagtgag tttgacatcttcatcaactacatagaagcctacatgacaatgaagatacgaaactga

DBGET integrated database retrieval system