Pan paniscus (bonobo): 100991779 Help Entry 100991779         CDS       T02283                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism pps  Pan paniscus (bonobo) Pathway pps03050   Proteasome pps04060   Cytokine-cytokine receptor interaction pps04066   HIF-1 signaling pathway pps04217   Necroptosis pps04350   TGF-beta signaling pathway pps04380   Osteoclast differentiation pps04612   Antigen processing and presentation pps04630   JAK-STAT signaling pathway pps04650   Natural killer cell mediated cytotoxicity pps04657   IL-17 signaling pathway pps04658   Th1 and Th2 cell differentiation pps04659   Th17 cell differentiation pps04660   T cell receptor signaling pathway pps04940   Type I diabetes mellitus pps05140   Leishmaniasis pps05142   Chagas disease pps05143   African trypanosomiasis pps05144   Malaria pps05145   Toxoplasmosis pps05146   Amoebiasis pps05152   Tuberculosis pps05160   Hepatitis C pps05164   Influenza A pps05168   Herpes simplex virus 1 infection pps05200   Pathways in cancer pps05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pps05321   Inflammatory bowel disease pps05322   Systemic lupus erythematosus pps05323   Rheumatoid arthritis pps05330   Allograft rejection pps05332   Graft-versus-host disease pps05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     100991779 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     100991779 (IFNG)    04630 JAK-STAT signaling pathway     100991779 (IFNG)    04066 HIF-1 signaling pathway     100991779 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100991779 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100991779 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     100991779 (IFNG)    04612 Antigen processing and presentation     100991779 (IFNG)    04660 T cell receptor signaling pathway     100991779 (IFNG)    04658 Th1 and Th2 cell differentiation     100991779 (IFNG)    04659 Th17 cell differentiation     100991779 (IFNG)    04657 IL-17 signaling pathway     100991779 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     100991779 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100991779 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100991779 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     100991779 (IFNG)    05164 Influenza A     100991779 (IFNG)    05168 Herpes simplex virus 1 infection     100991779 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     100991779 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     100991779 (IFNG)    05144 Malaria     100991779 (IFNG)    05145 Toxoplasmosis     100991779 (IFNG)    05140 Leishmaniasis     100991779 (IFNG)    05142 Chagas disease     100991779 (IFNG)    05143 African trypanosomiasis     100991779 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     100991779 (IFNG)    05323 Rheumatoid arthritis     100991779 (IFNG)    05321 Inflammatory bowel disease     100991779 (IFNG)    05330 Allograft rejection     100991779 (IFNG)    05332 Graft-versus-host disease     100991779 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100991779 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100991779 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:pps03051]     100991779 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100991779 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:pps00536]     100991779 (IFNG) Proteasome [BR:pps03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     100991779 (IFNG) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Interferons    100991779 (IFNG) Glycosaminoglycan binding proteins [BR:pps00536]  Heparan sulfate / Heparin   Cytokines    100991779 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma Y1_Tnp Tup_N Motif Other DBs NCBI-GeneID:  100991779 NCBI-ProteinID:  XP_003808753 Ensembl:  ENSPPAG00000042020 UniProt:  A0A2R9CC85 LinkDB All DBs Position 10:complement(76170643..76175506) Genome browser AA seq 166 aa AA seqDB search MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAVKTGKRKRSQMLFRGRRASQ NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatatacaagttatatcttggcttttcagctctgcatcgttttgggttctcttggc tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca ggtcattcagatgtagcagataatggaactcttttcttaggcattttgaagaattggaaa gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt aaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatg aatgtcaagtttttcaatagcaacaaaaagaaacgagatgacttcgaaaagctgactaat tattcggtaactgacttgaatgtccaacgcaaagcaatacatgaactcatccaagtgatg gctgaactgtcgccagcagttaaaacggggaagcgaaaaaggagtcagatgctgtttcga ggtcgaagagcatcccagtaa

DBGET integrated database retrieval system