Pan paniscus (bonobo): 100995851 Help Entry 100995851         CDS       T02283                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism pps  Pan paniscus (bonobo) Pathway pps04060   Cytokine-cytokine receptor interaction pps04151   PI3K-Akt signaling pathway pps04217   Necroptosis pps04380   Osteoclast differentiation pps04620   Toll-like receptor signaling pathway pps04621   NOD-like receptor signaling pathway pps04622   RIG-I-like receptor signaling pathway pps04623   Cytosolic DNA-sensing pathway pps04630   JAK-STAT signaling pathway pps04650   Natural killer cell mediated cytotoxicity pps04668   TNF signaling pathway pps04936   Alcoholic liver disease pps05135   Yersinia infection pps05142   Chagas disease pps05152   Tuberculosis pps05160   Hepatitis C pps05161   Hepatitis B pps05162   Measles pps05163   Human cytomegalovirus infection pps05164   Influenza A pps05165   Human papillomavirus infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05168   Herpes simplex virus 1 infection pps05169   Epstein-Barr virus infection pps05170   Human immunodeficiency virus 1 infection pps05171   Coronavirus disease pps05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100995851 (IFNB1)    04668 TNF signaling pathway     100995851 (IFNB1)    04151 PI3K-Akt signaling pathway     100995851 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100995851 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100995851 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100995851 (IFNB1)    04621 NOD-like receptor signaling pathway     100995851 (IFNB1)    04622 RIG-I-like receptor signaling pathway     100995851 (IFNB1)    04623 Cytosolic DNA-sensing pathway     100995851 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     100995851 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     100995851 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100995851 (IFNB1)    05161 Hepatitis B     100995851 (IFNB1)    05160 Hepatitis C     100995851 (IFNB1)    05171 Coronavirus disease     100995851 (IFNB1)    05164 Influenza A     100995851 (IFNB1)    05162 Measles     100995851 (IFNB1)    05168 Herpes simplex virus 1 infection     100995851 (IFNB1)    05163 Human cytomegalovirus infection     100995851 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     100995851 (IFNB1)    05169 Epstein-Barr virus infection     100995851 (IFNB1)    05165 Human papillomavirus infection     100995851 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     100995851 (IFNB1)    05152 Tuberculosis     100995851 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     100995851 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100995851 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100995851 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pps04052]     100995851 (IFNB1) Cytokines and neuropeptides [BR:pps04052]  Cytokines   Interferons    100995851 (IFNB1) SSDB OrthologParalogGFIT Motif Pfam:  Interferon Forkhead RMD9_N Ribosomal_S15 Motif Other DBs NCBI-GeneID:  100995851 NCBI-ProteinID:  XP_054948065 LinkDB All DBs Position 11:103458347..103470724 Genome browser AA seq 187 aa AA seqDB search MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNIQCQKLLWQLSGRLEYCLKDRMNFD IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK TVLEEKPEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR LAGYLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt tccatgagctacaacttgcttggattcctacaaagaagcagcaatattcagtgtcagaag ctcctgtggcaattgagtgggaggcttgaatattgcctcaaggacaggatgaactttgac atccctgaggagattaagcagctgcagcagttccagaaggaggacgccgcattgaccatc tatgagatgctccagaacatctttgctattttcagacaagattcatctagcactggctgg aatgagactattgttgagaacctcctggctaatgtctatcatcagataaaccatctgaag acagtcctggaagaaaaaccggagaaagaagatttcaccaggggaaaattcatgagcagt ctgcacctgaaaagatattatgggagaattctgcattacctgaaggccaaggagtacagt cactgtgcctggaccatagtcagagtggaaatcctaaggaacttttacttcattaacaga cttgcaggttacctccgaaactga

DBGET integrated database retrieval system