Pan paniscus (bonobo): 103786410 Help Entry 103786410         CDS       T02283                                  Symbol MYC Name (RefSeq) myc proto-oncogene protein   KO K04377   Myc proto-oncogene protein Organism pps  Pan paniscus (bonobo) Pathway pps04010   MAPK signaling pathway pps04012   ErbB signaling pathway pps04110   Cell cycle pps04151   PI3K-Akt signaling pathway pps04218   Cellular senescence pps04310   Wnt signaling pathway pps04350   TGF-beta signaling pathway pps04390   Hippo signaling pathway pps04550   Signaling pathways regulating pluripotency of stem cells pps04630   JAK-STAT signaling pathway pps04919   Thyroid hormone signaling pathway pps05132   Salmonella infection pps05160   Hepatitis C pps05161   Hepatitis B pps05163   Human cytomegalovirus infection pps05166   Human T-cell leukemia virus 1 infection pps05167   Kaposi sarcoma-associated herpesvirus infection pps05169   Epstein-Barr virus infection pps05200   Pathways in cancer pps05202   Transcriptional misregulation in cancer pps05205   Proteoglycans in cancer pps05206   MicroRNAs in cancer pps05207   Chemical carcinogenesis - receptor activation pps05210   Colorectal cancer pps05213   Endometrial cancer pps05216   Thyroid cancer pps05219   Bladder cancer pps05220   Chronic myeloid leukemia pps05221   Acute myeloid leukemia pps05222   Small cell lung cancer pps05224   Breast cancer pps05225   Hepatocellular carcinoma pps05226   Gastric cancer pps05230   Central carbon metabolism in cancer Brite KEGG Orthology (KO) [BR:pps00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103786410 (MYC)    04012 ErbB signaling pathway     103786410 (MYC)    04310 Wnt signaling pathway     103786410 (MYC)    04350 TGF-beta signaling pathway     103786410 (MYC)    04390 Hippo signaling pathway     103786410 (MYC)    04630 JAK-STAT signaling pathway     103786410 (MYC)    04151 PI3K-Akt signaling pathway     103786410 (MYC)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103786410 (MYC)    04218 Cellular senescence     103786410 (MYC)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     103786410 (MYC)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     103786410 (MYC)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103786410 (MYC)    05202 Transcriptional misregulation in cancer     103786410 (MYC)    05206 MicroRNAs in cancer     103786410 (MYC)    05205 Proteoglycans in cancer     103786410 (MYC)    05207 Chemical carcinogenesis - receptor activation     103786410 (MYC)    05230 Central carbon metabolism in cancer     103786410 (MYC)   09162 Cancer: specific types    05210 Colorectal cancer     103786410 (MYC)    05225 Hepatocellular carcinoma     103786410 (MYC)    05226 Gastric cancer     103786410 (MYC)    05216 Thyroid cancer     103786410 (MYC)    05221 Acute myeloid leukemia     103786410 (MYC)    05220 Chronic myeloid leukemia     103786410 (MYC)    05219 Bladder cancer     103786410 (MYC)    05213 Endometrial cancer     103786410 (MYC)    05224 Breast cancer     103786410 (MYC)    05222 Small cell lung cancer     103786410 (MYC)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103786410 (MYC)    05161 Hepatitis B     103786410 (MYC)    05160 Hepatitis C     103786410 (MYC)    05163 Human cytomegalovirus infection     103786410 (MYC)    05167 Kaposi sarcoma-associated herpesvirus infection     103786410 (MYC)    05169 Epstein-Barr virus infection     103786410 (MYC)   09171 Infectious disease: bacterial    05132 Salmonella infection     103786410 (MYC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pps03000]     103786410 (MYC)    03019 Messenger RNA biogenesis [BR:pps03019]     103786410 (MYC) Transcription factors [BR:pps03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Myc     103786410 (MYC) Messenger RNA biogenesis [BR:pps03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103786410 (MYC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Myc_N Myc-LZ HLH TRH Motif Other DBs NCBI-GeneID:  103786410 NCBI-ProteinID:  XP_003820503 UniProt:  A1YG22 LinkDB All DBs Position 7:145127238..145132177 Genome browser AA seq 439 aa AA seqDB search MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD LSAAASECIDPSVVFPYPLNDGSSPKSCPSQDSSAFSPSSDSLLSSTESSPQGSPEPLVL HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENDKRRTHN VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL RKRREQLKHKLEQLRNSCA NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt atgcccctcaacgttagcttcaccaacaggaactatgacctcgactacgactcggtgcag ccgtatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg cagcccccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc ctgtcccctagccgccgctccgggctctgctcgccctcctacgttgcggtcacgcccttc tcccttcggggagacaacgacggcggtggcgggagcttctccacggccgaccagctggag atggtgaccgagctgctgggaggagacatggtgaaccagagtttcatctgcgacccggac gacgagaccttcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc gccgccaagctcgtctcagagaagctggcctcctaccaggctgcgcgcaaagacagcggc agcccgaaccccgcccgcggccacagcgtctgctccacctccagcttgtacctgcaggat ctgagcgccgccgcctcagagtgcatcgacccctcggtggtcttcccctaccctctcaac gacggcagctcgcccaagtcctgcccctcgcaagactccagcgccttctctccgtcctcg gattctctgctctcctcgacggagtcctccccgcagggcagccccgagcccctggtgctc catgaggagacaccgcccaccaccagcagcgactctgaggaggaacaagaagatgaggaa gaaatcgatgttgtttctgtggaaaagaggcaggctcctggcaaaaggtcagagtctgga tcaccttctgctggaggccacagcaaacctcctcacagcccactggtcctcaagaggtgc cacgtctccacacatcagcacaactacgcagcgcctccctccactcggaaggactatcct gctgccaagagggtcaagttggacagtgttagagtcctgagacagatcagcaacaaccga aaatgcaccagccccaggtcctcggacaccgaggagaatgacaagaggcgaacacacaac gtcttggagcgccagaggaggaacgagctaaaacggagcttttttgccctgcgtgaccag atcccggagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccaca gcatacatcctgtccgtccaagcagaggagcaaaagctcatttctgaggaggacttgttg cggaaacgacgagaacagttgaaacacaaacttgaacagctacggaactcttgtgcgtaa

DBGET integrated database retrieval system