Pan paniscus (bonobo): 129395546 Help Entry 129395546         CDS       T02283                                  Symbol TMSB4Y Name (RefSeq) thymosin beta-4, Y-chromosomal   KO K05764   thymosin, beta 4 Organism pps  Pan paniscus (bonobo) Pathway pps04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pps00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129395546 (TMSB4Y)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pps04812]     129395546 (TMSB4Y) Cytoskeleton proteins [BR:pps04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      129395546 (TMSB4Y) SSDB OrthologParalogGFIT Motif Pfam:  Thymosin WH2 Qua1 Motif Other DBs NCBI-GeneID:  129395546 NCBI-ProteinID:  XP_054962988 LinkDB All DBs Position Y:39436818..39439222 Genome browser AA seq 44 aa AA seqDB search MSDKPGMAEIEKFDKSKLKKTETQDKNPLSSKETIEQEKQAGES NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaacctggtatggctgagatcgagaaattcgataagtcgaaactgaagaag acagaaacgcaagacaagaatccattgtcttccaaagaaacgatcgaacaggagaagcaa gcaggcgaatcttaa

DBGET integrated database retrieval system