Podospora pseudocomata: 87913627 Help Entry 87913627          CDS       T09797                                  Symbol HRT1 Name (RefSeq) RING-box protein hrt1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ppsd  Podospora pseudocomata Pathway ppsd03420   Nucleotide excision repair ppsd04111   Cell cycle - yeast ppsd04120   Ubiquitin mediated proteolysis ppsd04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ppsd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     87913627 (HRT1)    04120 Ubiquitin mediated proteolysis     87913627 (HRT1)   09124 Replication and repair    03420 Nucleotide excision repair     87913627 (HRT1)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     87913627 (HRT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ppsd04121]     87913627 (HRT1)    03400 DNA repair and recombination proteins [BR:ppsd03400]     87913627 (HRT1) Enzymes [BR:ppsd01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      87913627 (HRT1) Ubiquitin system [BR:ppsd04121]  Ubiquitin ligases (E3)   UBL E3 ligases    87913627 (HRT1)   Multi subunit type E3    SCF complex     Ring finger protein      87913627 (HRT1)    Cul2 complex      87913627 (HRT1)    Cul3 complex      87913627 (HRT1)    Cul4 complex      87913627 (HRT1)    Cul7 complex      87913627 (HRT1)    Cul8 complex      87913627 (HRT1)    Cul9 complex      87913627 (HRT1) DNA repair and recombination proteins [BR:ppsd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       87913627 (HRT1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       87913627 (HRT1) SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  87913627 NCBI-ProteinID:  XP_062739558 UniProt:  A0ABR0G4D5 LinkDB All DBs Position 7:complement(2496150..2497472) Genome browser AA seq 124 aa AA seqDB search MADVDMTDATDAPASAAPVTKKKGTAADGEGKDGKKRFEVKKWNAVALWAWDIVVDNCAI CRNHIMDLCIECQANQASATSEECTVAWGICNHAFHFHCISRWLKARQVCPLDNRDWEFQ KYGR NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggccgacgttgatatgaccgacgcgaccgacgcgcccgcctccgcggcccccgtcacc aagaagaagggcaccgccgctgacggagagggaaaggatgggaagaagcgcttcgaagtc aagaaatggaatgcggtagccttgtgggcctgggacatagtggtcgacaattgtgccatc tgccgaaaccacatcatggacttgtgtatagaatgtcaggcgaaccaagcttcagccacg agcgaggagtgcactgtagcctggggcatttgcaaccacgccttccacttccactgcatc tccagatggctcaaggcgcgccaagtatgcccactcgacaatagggactgggagttccag aagtacggccgatag

DBGET integrated database retrieval system