Pseudomonas putida KT2440: PP_0392 Help Entry PP_0392           CDS       T00114                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ppu  Pseudomonas putida KT2440 Pathway ppu00790   Folate biosynthesis ppu01100   Metabolic pathways ppu01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ppu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PP_0392 (folB) Enzymes [BR:ppu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      PP_0392 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      PP_0392 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      PP_0392 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AAN66023 UniProt:  Q88QU4 LinkDB All DBs Position 477396..477752 Genome browser AA seq 118 aa AA seqDB search MDRVFIEGLEVDTVIGAYDWERDIRQCLRLDLSFAWDNRPAAAGDDLNLALDYASVSARI QAFAEQARFELVETFAERLVATLMDEFHIPWVRLKLTKPGAVPAARGGVGVEIERGCL NT seq 357 nt NT seq  +upstreamnt  +downstreamnt ttggacagagtgttcatcgaaggcctggaagtcgataccgtcatcggtgcctatgactgg gagcgggatattcgccagtgcttgcgcctggacctgagctttgcctgggacaaccgcccg gccgccgccggagacgacctgaacctggcgctggattacgccagtgtgtcggcgcgcatc caggcgtttgccgaacaggcccgtttcgagctggttgagacatttgccgagcgcctggtg gcaaccctgatggacgagttccacatcccctgggtgcgcttgaagctgaccaagccgggc gcggtgccggcggcccgtggtggtgttggcgtggagatcgagcgcggatgtctctga

DBGET integrated database retrieval system