Paenibacillus polymyxa E681: PPE_00069 Help Entry PPE_00069         CDS       T01319                                  Name (GenBank) dienelactone hydrolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ppy  Paenibacillus polymyxa E681 Pathway ppy00790   Folate biosynthesis ppy01100   Metabolic pathways ppy01240   Biosynthesis of cofactors Module ppy_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ppy00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PPE_00069 Enzymes [BR:ppy01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      PPE_00069  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      PPE_00069  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      PPE_00069 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ADM67971 LinkDB All DBs Position 73967..74329 Genome browser AA seq 120 aa AA seqDB search MDKMVLHRMEYYGYHGVFPEERKLGQRFYIDLELELDLREAGKQDALDKTVNYAEVHYTV KDIVEKESYQLIEALGERIASSLLDTYTSVNALTVKVTKPHPPFDIHFQGVTVELYRARK NT seq 363 nt NT seq  +upstreamnt  +downstreamnt gtggataaaatggttttgcatcgtatggagtattacggatatcatggcgtttttccagag gaacgtaagctgggacagcgtttctacattgatttggaactggagcttgatctgcgtgaa gcgggtaagcaggatgctttggacaaaacggttaattacgccgaggtacattacaccgtt aaagatattgtagaaaaggaatcttaccaattgattgaagctttgggcgaacgcattgca tcttccctactggacacttatactagtgtcaatgcactgactgtcaaagtcacgaagccg catccgccgtttgatattcattttcaaggcgtgacggttgagctttatcgcgcaagaaag tag

DBGET integrated database retrieval system