Pongo pygmaeus (Bornean orangutan): 129008417 Help Entry 129008417         CDS       T10128                                  Symbol RELA Name (RefSeq) transcription factor P65   KO K04735   transcription factor p65 Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg01523   Antifolate resistance ppyg04010   MAPK signaling pathway ppyg04014   Ras signaling pathway ppyg04024   cAMP signaling pathway ppyg04062   Chemokine signaling pathway ppyg04064   NF-kappa B signaling pathway ppyg04066   HIF-1 signaling pathway ppyg04071   Sphingolipid signaling pathway ppyg04137   Mitophagy - animal ppyg04151   PI3K-Akt signaling pathway ppyg04210   Apoptosis ppyg04211   Longevity regulating pathway ppyg04218   Cellular senescence ppyg04380   Osteoclast differentiation ppyg04613   Neutrophil extracellular trap formation ppyg04620   Toll-like receptor signaling pathway ppyg04621   NOD-like receptor signaling pathway ppyg04622   RIG-I-like receptor signaling pathway ppyg04623   Cytosolic DNA-sensing pathway ppyg04625   C-type lectin receptor signaling pathway ppyg04657   IL-17 signaling pathway ppyg04658   Th1 and Th2 cell differentiation ppyg04659   Th17 cell differentiation ppyg04660   T cell receptor signaling pathway ppyg04662   B cell receptor signaling pathway ppyg04668   TNF signaling pathway ppyg04722   Neurotrophin signaling pathway ppyg04917   Prolactin signaling pathway ppyg04920   Adipocytokine signaling pathway ppyg04926   Relaxin signaling pathway ppyg04931   Insulin resistance ppyg04932   Non-alcoholic fatty liver disease ppyg04933   AGE-RAGE signaling pathway in diabetic complications ppyg04936   Alcoholic liver disease ppyg05010   Alzheimer disease ppyg05022   Pathways of neurodegeneration - multiple diseases ppyg05030   Cocaine addiction ppyg05132   Salmonella infection ppyg05133   Pertussis ppyg05134   Legionellosis ppyg05135   Yersinia infection ppyg05140   Leishmaniasis ppyg05142   Chagas disease ppyg05145   Toxoplasmosis ppyg05146   Amoebiasis ppyg05152   Tuberculosis ppyg05160   Hepatitis C ppyg05161   Hepatitis B ppyg05162   Measles ppyg05163   Human cytomegalovirus infection ppyg05164   Influenza A ppyg05165   Human papillomavirus infection ppyg05166   Human T-cell leukemia virus 1 infection ppyg05167   Kaposi sarcoma-associated herpesvirus infection ppyg05168   Herpes simplex virus 1 infection ppyg05169   Epstein-Barr virus infection ppyg05170   Human immunodeficiency virus 1 infection ppyg05171   Coronavirus disease - COVID-19 ppyg05200   Pathways in cancer ppyg05202   Transcriptional misregulation in cancer ppyg05203   Viral carcinogenesis ppyg05207   Chemical carcinogenesis - receptor activation ppyg05208   Chemical carcinogenesis - reactive oxygen species ppyg05212   Pancreatic cancer ppyg05215   Prostate cancer ppyg05220   Chronic myeloid leukemia ppyg05221   Acute myeloid leukemia ppyg05222   Small cell lung cancer ppyg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ppyg05321   Inflammatory bowel disease ppyg05415   Diabetic cardiomyopathy ppyg05417   Lipid and atherosclerosis ppyg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129008417 (RELA)    04014 Ras signaling pathway     129008417 (RELA)    04064 NF-kappa B signaling pathway     129008417 (RELA)    04668 TNF signaling pathway     129008417 (RELA)    04066 HIF-1 signaling pathway     129008417 (RELA)    04071 Sphingolipid signaling pathway     129008417 (RELA)    04024 cAMP signaling pathway     129008417 (RELA)    04151 PI3K-Akt signaling pathway     129008417 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     129008417 (RELA)   09143 Cell growth and death    04210 Apoptosis     129008417 (RELA)    04218 Cellular senescence     129008417 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129008417 (RELA)    04620 Toll-like receptor signaling pathway     129008417 (RELA)    04621 NOD-like receptor signaling pathway     129008417 (RELA)    04622 RIG-I-like receptor signaling pathway     129008417 (RELA)    04623 Cytosolic DNA-sensing pathway     129008417 (RELA)    04625 C-type lectin receptor signaling pathway     129008417 (RELA)    04660 T cell receptor signaling pathway     129008417 (RELA)    04658 Th1 and Th2 cell differentiation     129008417 (RELA)    04659 Th17 cell differentiation     129008417 (RELA)    04657 IL-17 signaling pathway     129008417 (RELA)    04662 B cell receptor signaling pathway     129008417 (RELA)    04062 Chemokine signaling pathway     129008417 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     129008417 (RELA)    04917 Prolactin signaling pathway     129008417 (RELA)    04926 Relaxin signaling pathway     129008417 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     129008417 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     129008417 (RELA)   09149 Aging    04211 Longevity regulating pathway     129008417 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129008417 (RELA)    05202 Transcriptional misregulation in cancer     129008417 (RELA)    05207 Chemical carcinogenesis - receptor activation     129008417 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     129008417 (RELA)    05203 Viral carcinogenesis     129008417 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129008417 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     129008417 (RELA)    05221 Acute myeloid leukemia     129008417 (RELA)    05220 Chronic myeloid leukemia     129008417 (RELA)    05215 Prostate cancer     129008417 (RELA)    05222 Small cell lung cancer     129008417 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129008417 (RELA)    05170 Human immunodeficiency virus 1 infection     129008417 (RELA)    05161 Hepatitis B     129008417 (RELA)    05160 Hepatitis C     129008417 (RELA)    05171 Coronavirus disease - COVID-19     129008417 (RELA)    05164 Influenza A     129008417 (RELA)    05162 Measles     129008417 (RELA)    05168 Herpes simplex virus 1 infection     129008417 (RELA)    05163 Human cytomegalovirus infection     129008417 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     129008417 (RELA)    05169 Epstein-Barr virus infection     129008417 (RELA)    05165 Human papillomavirus infection     129008417 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     129008417 (RELA)    05135 Yersinia infection     129008417 (RELA)    05133 Pertussis     129008417 (RELA)    05134 Legionellosis     129008417 (RELA)    05152 Tuberculosis     129008417 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     129008417 (RELA)    05145 Toxoplasmosis     129008417 (RELA)    05140 Leishmaniasis     129008417 (RELA)    05142 Chagas disease     129008417 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     129008417 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     129008417 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     129008417 (RELA)   09165 Substance dependence    05030 Cocaine addiction     129008417 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129008417 (RELA)    05418 Fluid shear stress and atherosclerosis     129008417 (RELA)    05415 Diabetic cardiomyopathy     129008417 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129008417 (RELA)    04932 Non-alcoholic fatty liver disease     129008417 (RELA)    04931 Insulin resistance     129008417 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     129008417 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     129008417 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ppyg03000]     129008417 (RELA) Transcription factors [BR:ppyg03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     129008417 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  129008417 NCBI-ProteinID:  XP_054296639 LinkDB All DBs Position 9:9023743..9034537 Genome browser AA seq 551 aa AA seqDB search MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAINQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFSGPTDSRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY DEFPTMVFPSGQISQASALAPAPPQVLPQASAPAPAPAMVSALAQAPAPVPVLPPGPPQA VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM DFSALLSQISS NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc atcaagatcaatggctacacaggaccagggacagtacgcatctccctggtcaccaaggac cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt gtgaagaagcgggacctggagcaggctatcaatcagcgcatccagaccaacaacaacccc ttccaagttcctatagaagagcagcgtggggactatgacctgaatgctgtgcggctctgc ttccaggtgacagtgcgggatccatcaggcaggcccctccgcctgccgcctgtcctttct catcccatctttgacaatcgtgcccccaacactgccgagctcaagatctgccgagtgaac cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg caagctgatgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag aaacgcaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga cccaccgactcccggcctccacctcgacgcattgctgtgccttcccgcagctcagcttct gtccccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat gatgagtttcccaccatggtgtttccttctgggcagataagccaggcctcagccttggcc ccggcccctccccaagtcctgccccaggcttcagcccctgcccctgctccagccatggta tcagctctggcccaggccccagcccctgtcccagtcctacccccaggccctcctcaggct gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca gccgtgttcacagacctggcatccgtcgacaactccgagtttcagcagctgctgaaccag ggcatacctgtggccccccacacaactgagcccatgctgatggagtaccctgaggctata actcgcctagtgacaggggcccagaggccccccgacccagctcctgctccactgggggcc ccagggctccccaacggcctcctttcaggagatgaagacttctcttccattgcggacatg gacttctcagccctgctgagtcagatcagctcctaa

DBGET integrated database retrieval system