Pongo pygmaeus (Bornean orangutan): 129009437 Help Entry 129009437         CDS       T10128                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg01522   Endocrine resistance ppyg04110   Cell cycle ppyg04115   p53 signaling pathway ppyg04151   PI3K-Akt signaling pathway ppyg04218   Cellular senescence ppyg04530   Tight junction ppyg04660   T cell receptor signaling pathway ppyg04933   AGE-RAGE signaling pathway in diabetic complications ppyg04934   Cushing syndrome ppyg05160   Hepatitis C ppyg05162   Measles ppyg05163   Human cytomegalovirus infection ppyg05164   Influenza A ppyg05165   Human papillomavirus infection ppyg05166   Human T-cell leukemia virus 1 infection ppyg05167   Kaposi sarcoma-associated herpesvirus infection ppyg05169   Epstein-Barr virus infection ppyg05200   Pathways in cancer ppyg05203   Viral carcinogenesis ppyg05212   Pancreatic cancer ppyg05214   Glioma ppyg05218   Melanoma ppyg05219   Bladder cancer ppyg05220   Chronic myeloid leukemia ppyg05222   Small cell lung cancer ppyg05223   Non-small cell lung cancer ppyg05224   Breast cancer ppyg05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     129009437 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     129009437 (CDK4)    04115 p53 signaling pathway     129009437 (CDK4)    04218 Cellular senescence     129009437 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     129009437 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     129009437 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129009437 (CDK4)    05203 Viral carcinogenesis     129009437 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     129009437 (CDK4)    05225 Hepatocellular carcinoma     129009437 (CDK4)    05214 Glioma     129009437 (CDK4)    05220 Chronic myeloid leukemia     129009437 (CDK4)    05218 Melanoma     129009437 (CDK4)    05219 Bladder cancer     129009437 (CDK4)    05224 Breast cancer     129009437 (CDK4)    05222 Small cell lung cancer     129009437 (CDK4)    05223 Non-small cell lung cancer     129009437 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129009437 (CDK4)    05160 Hepatitis C     129009437 (CDK4)    05164 Influenza A     129009437 (CDK4)    05162 Measles     129009437 (CDK4)    05163 Human cytomegalovirus infection     129009437 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     129009437 (CDK4)    05169 Epstein-Barr virus infection     129009437 (CDK4)    05165 Human papillomavirus infection     129009437 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     129009437 (CDK4)    04934 Cushing syndrome     129009437 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     129009437 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ppyg01001]     129009437 (CDK4) Enzymes [BR:ppyg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      129009437 (CDK4) Protein kinases [BR:ppyg01001]  Serine/threonine kinases: CMGC group   CDK family    129009437 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  129009437 NCBI-ProteinID:  XP_054298312 LinkDB All DBs Position 10:complement(55563214..55568117) Genome browser AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc aatggaggaggagctggaggaggccttcccatcagcacagttcgtgaggtggctttactg aggcgactggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccaca tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaggaccta aggacgtatctggacaaggcacccccaccaggcttgccagccgaaaccatcaaggatctg atgcgccagtttctaagaggcctagatttccttcatgccaattgcatcgttcaccgagat ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagcc gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg gtacctgagatggaggagtcgggagcgcagctgctgctggaaatgctgacttttaaccca cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt aatccggagtga

DBGET integrated database retrieval system