Pongo pygmaeus (Bornean orangutan): 129012966 Help Entry 129012966         CDS       T10128                                  Symbol FOS Name (RefSeq) protein C-Fos   KO K04379   proto-oncogene protein c-fos Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg01522   Endocrine resistance ppyg04010   MAPK signaling pathway ppyg04024   cAMP signaling pathway ppyg04210   Apoptosis ppyg04380   Osteoclast differentiation ppyg04620   Toll-like receptor signaling pathway ppyg04657   IL-17 signaling pathway ppyg04658   Th1 and Th2 cell differentiation ppyg04659   Th17 cell differentiation ppyg04660   T cell receptor signaling pathway ppyg04662   B cell receptor signaling pathway ppyg04668   TNF signaling pathway ppyg04713   Circadian entrainment ppyg04725   Cholinergic synapse ppyg04728   Dopaminergic synapse ppyg04915   Estrogen signaling pathway ppyg04917   Prolactin signaling pathway ppyg04921   Oxytocin signaling pathway ppyg04926   Relaxin signaling pathway ppyg04928   Parathyroid hormone synthesis, secretion and action ppyg04932   Non-alcoholic fatty liver disease ppyg04935   Growth hormone synthesis, secretion and action ppyg05031   Amphetamine addiction ppyg05132   Salmonella infection ppyg05133   Pertussis ppyg05135   Yersinia infection ppyg05140   Leishmaniasis ppyg05142   Chagas disease ppyg05161   Hepatitis B ppyg05162   Measles ppyg05166   Human T-cell leukemia virus 1 infection ppyg05167   Kaposi sarcoma-associated herpesvirus infection ppyg05170   Human immunodeficiency virus 1 infection ppyg05171   Coronavirus disease ppyg05200   Pathways in cancer ppyg05207   Chemical carcinogenesis - receptor activation ppyg05208   Chemical carcinogenesis - reactive oxygen species ppyg05210   Colorectal cancer ppyg05224   Breast cancer ppyg05231   Choline metabolism in cancer ppyg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ppyg05323   Rheumatoid arthritis ppyg05417   Lipid and atherosclerosis ppyg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129012966 (FOS)    04668 TNF signaling pathway     129012966 (FOS)    04024 cAMP signaling pathway     129012966 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     129012966 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129012966 (FOS)    04660 T cell receptor signaling pathway     129012966 (FOS)    04658 Th1 and Th2 cell differentiation     129012966 (FOS)    04659 Th17 cell differentiation     129012966 (FOS)    04657 IL-17 signaling pathway     129012966 (FOS)    04662 B cell receptor signaling pathway     129012966 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     129012966 (FOS)    04917 Prolactin signaling pathway     129012966 (FOS)    04921 Oxytocin signaling pathway     129012966 (FOS)    04926 Relaxin signaling pathway     129012966 (FOS)    04935 Growth hormone synthesis, secretion and action     129012966 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     129012966 (FOS)   09156 Nervous system    04725 Cholinergic synapse     129012966 (FOS)    04728 Dopaminergic synapse     129012966 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     129012966 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     129012966 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129012966 (FOS)    05207 Chemical carcinogenesis - receptor activation     129012966 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     129012966 (FOS)    05231 Choline metabolism in cancer     129012966 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129012966 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     129012966 (FOS)    05224 Breast cancer     129012966 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129012966 (FOS)    05170 Human immunodeficiency virus 1 infection     129012966 (FOS)    05161 Hepatitis B     129012966 (FOS)    05171 Coronavirus disease     129012966 (FOS)    05162 Measles     129012966 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     129012966 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     129012966 (FOS)    05135 Yersinia infection     129012966 (FOS)    05133 Pertussis     129012966 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     129012966 (FOS)    05142 Chagas disease     129012966 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     129012966 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     129012966 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129012966 (FOS)    05418 Fluid shear stress and atherosclerosis     129012966 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     129012966 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     129012966 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ppyg03000]     129012966 (FOS)    04131 Membrane trafficking [BR:ppyg04131]     129012966 (FOS) Transcription factors [BR:ppyg03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     129012966 (FOS) Membrane trafficking [BR:ppyg04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     129012966 (FOS) SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 CCDC110 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  129012966 NCBI-ProteinID:  XP_054305151 LinkDB All DBs Position 15:74208584..74212032 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcccgctgcagcagcgcg tccccggccggggatagcctctcctactaccactcacccgccgactccttctccagcatg ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc attcccacggtcactgccatctcgaccagtccggacctgcagtggctggtgcagcctgcc ctcgtctcctccgtggccccatcgcagaccagagcccctcaccctttcggagtccccacc ccctccgctggggcttactccagggctggcgttgtgaagaccatgacaggaggccgagcg cagagcattggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag accgagattgccaacctgctaaaggagaaggaaaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc cttgatctgactgggggcctgccagaggttgccaccccggagtctgaggaggccttcacc ctgcctctcctcaatgaccctgagcccaagccctcagtggaacctgtcaagagcatcagc agcatggagctgaaggccgagccgtttgatgacttcctgttcccagcatcatccaggccc agcggctctgagacagcccgctctgtgccagacatggacctatctgggtccttctatgca gcagactgggagcctctgcacagtggctccctgggaatggggcccatggccacagagctg gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgcgcagctgcccaccgcaag ggcagcagcagcaatgagccttcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system