Pongo pygmaeus (Bornean orangutan): 129018687 Help Entry 129018687         CDS       T10128                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg01521   EGFR tyrosine kinase inhibitor resistance ppyg01522   Endocrine resistance ppyg01524   Platinum drug resistance ppyg04064   NF-kappa B signaling pathway ppyg04066   HIF-1 signaling pathway ppyg04071   Sphingolipid signaling pathway ppyg04115   p53 signaling pathway ppyg04140   Autophagy - animal ppyg04141   Protein processing in endoplasmic reticulum ppyg04151   PI3K-Akt signaling pathway ppyg04210   Apoptosis ppyg04215   Apoptosis - multiple species ppyg04217   Necroptosis ppyg04261   Adrenergic signaling in cardiomyocytes ppyg04340   Hedgehog signaling pathway ppyg04510   Focal adhesion ppyg04621   NOD-like receptor signaling pathway ppyg04630   JAK-STAT signaling pathway ppyg04722   Neurotrophin signaling pathway ppyg04725   Cholinergic synapse ppyg04915   Estrogen signaling pathway ppyg04928   Parathyroid hormone synthesis, secretion and action ppyg04933   AGE-RAGE signaling pathway in diabetic complications ppyg05014   Amyotrophic lateral sclerosis ppyg05022   Pathways of neurodegeneration - multiple diseases ppyg05132   Salmonella infection ppyg05145   Toxoplasmosis ppyg05152   Tuberculosis ppyg05161   Hepatitis B ppyg05162   Measles ppyg05168   Herpes simplex virus 1 infection ppyg05169   Epstein-Barr virus infection ppyg05170   Human immunodeficiency virus 1 infection ppyg05200   Pathways in cancer ppyg05206   MicroRNAs in cancer ppyg05207   Chemical carcinogenesis - receptor activation ppyg05210   Colorectal cancer ppyg05215   Prostate cancer ppyg05222   Small cell lung cancer ppyg05226   Gastric cancer ppyg05417   Lipid and atherosclerosis ppyg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     129018687 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     129018687 (BCL2)    04630 JAK-STAT signaling pathway     129018687 (BCL2)    04064 NF-kappa B signaling pathway     129018687 (BCL2)    04066 HIF-1 signaling pathway     129018687 (BCL2)    04071 Sphingolipid signaling pathway     129018687 (BCL2)    04151 PI3K-Akt signaling pathway     129018687 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129018687 (BCL2)   09143 Cell growth and death    04210 Apoptosis     129018687 (BCL2)    04215 Apoptosis - multiple species     129018687 (BCL2)    04217 Necroptosis     129018687 (BCL2)    04115 p53 signaling pathway     129018687 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     129018687 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     129018687 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     129018687 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     129018687 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     129018687 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     129018687 (BCL2)    04722 Neurotrophin signaling pathway     129018687 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129018687 (BCL2)    05206 MicroRNAs in cancer     129018687 (BCL2)    05207 Chemical carcinogenesis - receptor activation     129018687 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     129018687 (BCL2)    05226 Gastric cancer     129018687 (BCL2)    05215 Prostate cancer     129018687 (BCL2)    05222 Small cell lung cancer     129018687 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129018687 (BCL2)    05161 Hepatitis B     129018687 (BCL2)    05162 Measles     129018687 (BCL2)    05168 Herpes simplex virus 1 infection     129018687 (BCL2)    05169 Epstein-Barr virus infection     129018687 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     129018687 (BCL2)    05152 Tuberculosis     129018687 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     129018687 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     129018687 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     129018687 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129018687 (BCL2)    05418 Fluid shear stress and atherosclerosis     129018687 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     129018687 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     129018687 (BCL2)    01524 Platinum drug resistance     129018687 (BCL2)    01522 Endocrine resistance     129018687 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ppyg01009]     129018687 (BCL2) Protein phosphatases and associated proteins [BR:ppyg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      129018687 (BCL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  129018687 NCBI-ProteinID:  XP_054316366 LinkDB All DBs Position 17:complement(78051140..78250626) Genome browser AA seq 239 aa AA seqDB search MAHAGTTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAATAPGIFSSQPGHTPHPA ASRDPVARTSPLPTPAAPGAAVGPALSPAPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggacaacagggtacgataaccgggagatagtgatgaagtacatccat tataagttgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccg ggggccgccaccgcacccggcatcttctcctcccagcccgggcacacgcctcatccagcc gcatcccgggacccggtcgccaggacctcgccgctgccgaccccggctgcccctggcgcc gccgtggggcctgcgctcagcccggcgccacctgtggtccacctgaccctccgccaggcc ggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac ctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaa ctgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctg ctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system