Pongo pygmaeus (Bornean orangutan): 129032072 Help Entry 129032072         CDS       T10128                                  Symbol IL10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04060   Cytokine-cytokine receptor interaction ppyg04061   Viral protein interaction with cytokine and cytokine receptor ppyg04068   FoxO signaling pathway ppyg04148   Efferocytosis ppyg04625   C-type lectin receptor signaling pathway ppyg04630   JAK-STAT signaling pathway ppyg04660   T cell receptor signaling pathway ppyg04672   Intestinal immune network for IgA production ppyg05133   Pertussis ppyg05135   Yersinia infection ppyg05140   Leishmaniasis ppyg05142   Chagas disease ppyg05143   African trypanosomiasis ppyg05144   Malaria ppyg05145   Toxoplasmosis ppyg05146   Amoebiasis ppyg05150   Staphylococcus aureus infection ppyg05152   Tuberculosis ppyg05310   Asthma ppyg05320   Autoimmune thyroid disease ppyg05321   Inflammatory bowel disease ppyg05322   Systemic lupus erythematosus ppyg05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129032072 (IL10)    04068 FoxO signaling pathway     129032072 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129032072 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     129032072 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     129032072 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129032072 (IL10)    04660 T cell receptor signaling pathway     129032072 (IL10)    04672 Intestinal immune network for IgA production     129032072 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     129032072 (IL10)    05133 Pertussis     129032072 (IL10)    05150 Staphylococcus aureus infection     129032072 (IL10)    05152 Tuberculosis     129032072 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     129032072 (IL10)    05144 Malaria     129032072 (IL10)    05145 Toxoplasmosis     129032072 (IL10)    05140 Leishmaniasis     129032072 (IL10)    05142 Chagas disease     129032072 (IL10)    05143 African trypanosomiasis     129032072 (IL10)   09163 Immune disease    05310 Asthma     129032072 (IL10)    05322 Systemic lupus erythematosus     129032072 (IL10)    05320 Autoimmune thyroid disease     129032072 (IL10)    05321 Inflammatory bowel disease     129032072 (IL10)    05330 Allograft rejection     129032072 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppyg04052]     129032072 (IL10)    00536 Glycosaminoglycan binding proteins [BR:ppyg00536]     129032072 (IL10) Cytokines and neuropeptides [BR:ppyg04052]  Cytokines   Interleukins    129032072 (IL10) Glycosaminoglycan binding proteins [BR:ppyg00536]  Heparan sulfate / Heparin   Cytokines    129032072 (IL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 IL22 ALIX_LYPXL_bnd CLZ DUF6364 Motif Other DBs NCBI-GeneID:  129032072 NCBI-ProteinID:  XP_054335076 LinkDB All DBs Position 1:42683604..42690508 Genome browser AA seq 178 aa AA seqDB search MHSSALLCCLVLLTGVRAGSGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKEHVNSLGENLKTLR LRLRRCHRFLPCENKSKAVQQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcacagctcagcactgctctgttgcctggtcctcctgactggcgtgagggccggctca ggccagggcacccagtctgagaacagctgcacccacttcccaggcaacctgcctaacatg cttcgagatctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag ctggacaacttgttgttaaaggagtccttgctggaggactttaagggttacctgggttgc caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac caagacccagacatcaaggagcatgtgaactccctgggggagaacctgaagaccctcagg ctgaggctgcggcgctgtcatcgatttcttccctgtgaaaataagagcaaggccgtgcag caggtgaagaatgcctttaataagctccaagagaaaggcatctacaaagccatgagcgag tttgacatcttcatcaactacatagaagcctacatgacaatgaagatacgaaactga

DBGET integrated database retrieval system