Pongo pygmaeus (Bornean orangutan): 129036373 Help Entry 129036373         CDS       T10128                                  Symbol IL4 Name (RefSeq) interleukin-4 isoform X1   KO K05430   interleukin 4 Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04060   Cytokine-cytokine receptor interaction ppyg04151   PI3K-Akt signaling pathway ppyg04630   JAK-STAT signaling pathway ppyg04640   Hematopoietic cell lineage ppyg04657   IL-17 signaling pathway ppyg04658   Th1 and Th2 cell differentiation ppyg04659   Th17 cell differentiation ppyg04660   T cell receptor signaling pathway ppyg04664   Fc epsilon RI signaling pathway ppyg04672   Intestinal immune network for IgA production ppyg05140   Leishmaniasis ppyg05200   Pathways in cancer ppyg05310   Asthma ppyg05320   Autoimmune thyroid disease ppyg05321   Inflammatory bowel disease ppyg05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129036373 (IL4)    04151 PI3K-Akt signaling pathway     129036373 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129036373 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     129036373 (IL4)    04660 T cell receptor signaling pathway     129036373 (IL4)    04658 Th1 and Th2 cell differentiation     129036373 (IL4)    04659 Th17 cell differentiation     129036373 (IL4)    04657 IL-17 signaling pathway     129036373 (IL4)    04664 Fc epsilon RI signaling pathway     129036373 (IL4)    04672 Intestinal immune network for IgA production     129036373 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129036373 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     129036373 (IL4)   09163 Immune disease    05310 Asthma     129036373 (IL4)    05320 Autoimmune thyroid disease     129036373 (IL4)    05321 Inflammatory bowel disease     129036373 (IL4)    05330 Allograft rejection     129036373 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppyg04052]     129036373 (IL4)    00536 Glycosaminoglycan binding proteins [BR:ppyg00536]     129036373 (IL4) Cytokines and neuropeptides [BR:ppyg04052]  Cytokines   Interleukins    129036373 (IL4) Glycosaminoglycan binding proteins [BR:ppyg00536]  Heparan sulfate / Heparin   Cytokines    129036373 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Mannosyl_trans3 Tfb5 Motif Other DBs NCBI-GeneID:  129036373 NCBI-ProteinID:  XP_054343355 LinkDB All DBs Position 4:137195929..137204450 Genome browser AA seq 153 aa AA seqDB search MGLTSQLLPPLFFLLACAGNFVHGHKCDIALQEIIKTLNSLTEQKTLCTELTVTDIFAAS KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL NSCPVKEANQSTLEDFLERLKTIMREKYSKCSS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac tttgtccatggacacaagtgcgatatcgccttacaagagatcatcaaaactttgaacagc ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatctttgctgcctcc aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac agccaccatgagaaggacactcgctgtctgggtgcgactgcacagcagttccacagacac aagcagctcatccgattcctgaaacggctcgacaggaacctctggggcctggcgggtttg aattcctgtcctgtgaaggaagccaaccagagtacgttggaagacttcttggaaaggcta aagacgatcatgagagaaaaatattcaaagtgttcgagctga

DBGET integrated database retrieval system