Pongo pygmaeus (Bornean orangutan): 129040398 Help Entry 129040398         CDS       T10128                                  Symbol IL6 Name (RefSeq) interleukin-6 isoform X1   KO K05405   interleukin 6 Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg01521   EGFR tyrosine kinase inhibitor resistance ppyg01523   Antifolate resistance ppyg04060   Cytokine-cytokine receptor interaction ppyg04061   Viral protein interaction with cytokine and cytokine receptor ppyg04066   HIF-1 signaling pathway ppyg04068   FoxO signaling pathway ppyg04151   PI3K-Akt signaling pathway ppyg04218   Cellular senescence ppyg04620   Toll-like receptor signaling pathway ppyg04621   NOD-like receptor signaling pathway ppyg04623   Cytosolic DNA-sensing pathway ppyg04625   C-type lectin receptor signaling pathway ppyg04630   JAK-STAT signaling pathway ppyg04640   Hematopoietic cell lineage ppyg04657   IL-17 signaling pathway ppyg04659   Th17 cell differentiation ppyg04668   TNF signaling pathway ppyg04672   Intestinal immune network for IgA production ppyg04931   Insulin resistance ppyg04932   Non-alcoholic fatty liver disease ppyg04933   AGE-RAGE signaling pathway in diabetic complications ppyg04936   Alcoholic liver disease ppyg05010   Alzheimer disease ppyg05020   Prion disease ppyg05022   Pathways of neurodegeneration - multiple diseases ppyg05132   Salmonella infection ppyg05133   Pertussis ppyg05134   Legionellosis ppyg05135   Yersinia infection ppyg05142   Chagas disease ppyg05143   African trypanosomiasis ppyg05144   Malaria ppyg05146   Amoebiasis ppyg05152   Tuberculosis ppyg05161   Hepatitis B ppyg05162   Measles ppyg05163   Human cytomegalovirus infection ppyg05164   Influenza A ppyg05166   Human T-cell leukemia virus 1 infection ppyg05167   Kaposi sarcoma-associated herpesvirus infection ppyg05168   Herpes simplex virus 1 infection ppyg05169   Epstein-Barr virus infection ppyg05171   Coronavirus disease ppyg05200   Pathways in cancer ppyg05202   Transcriptional misregulation in cancer ppyg05321   Inflammatory bowel disease ppyg05323   Rheumatoid arthritis ppyg05332   Graft-versus-host disease ppyg05410   Hypertrophic cardiomyopathy ppyg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129040398 (IL6)    04668 TNF signaling pathway     129040398 (IL6)    04066 HIF-1 signaling pathway     129040398 (IL6)    04068 FoxO signaling pathway     129040398 (IL6)    04151 PI3K-Akt signaling pathway     129040398 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129040398 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     129040398 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     129040398 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     129040398 (IL6)    04620 Toll-like receptor signaling pathway     129040398 (IL6)    04621 NOD-like receptor signaling pathway     129040398 (IL6)    04623 Cytosolic DNA-sensing pathway     129040398 (IL6)    04625 C-type lectin receptor signaling pathway     129040398 (IL6)    04659 Th17 cell differentiation     129040398 (IL6)    04657 IL-17 signaling pathway     129040398 (IL6)    04672 Intestinal immune network for IgA production     129040398 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129040398 (IL6)    05202 Transcriptional misregulation in cancer     129040398 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129040398 (IL6)    05161 Hepatitis B     129040398 (IL6)    05171 Coronavirus disease     129040398 (IL6)    05164 Influenza A     129040398 (IL6)    05162 Measles     129040398 (IL6)    05168 Herpes simplex virus 1 infection     129040398 (IL6)    05163 Human cytomegalovirus infection     129040398 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     129040398 (IL6)    05169 Epstein-Barr virus infection     129040398 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     129040398 (IL6)    05135 Yersinia infection     129040398 (IL6)    05133 Pertussis     129040398 (IL6)    05134 Legionellosis     129040398 (IL6)    05152 Tuberculosis     129040398 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     129040398 (IL6)    05144 Malaria     129040398 (IL6)    05142 Chagas disease     129040398 (IL6)    05143 African trypanosomiasis     129040398 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     129040398 (IL6)    05321 Inflammatory bowel disease     129040398 (IL6)    05332 Graft-versus-host disease     129040398 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     129040398 (IL6)    05020 Prion disease     129040398 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     129040398 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129040398 (IL6)    05410 Hypertrophic cardiomyopathy     129040398 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129040398 (IL6)    04932 Non-alcoholic fatty liver disease     129040398 (IL6)    04931 Insulin resistance     129040398 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     129040398 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     129040398 (IL6)    01523 Antifolate resistance     129040398 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppyg04052]     129040398 (IL6) Cytokines and neuropeptides [BR:ppyg04052]  Cytokines   Interleukins    129040398 (IL6) SSDB OrthologParalogGFIT Motif Pfam:  IL6 Motif Other DBs NCBI-GeneID:  129040398 NCBI-ProteinID:  XP_054350847 LinkDB All DBs Position 6:complement(64000010..64006682) Genome browser AA seq 252 aa AA seqDB search MNSVSTSKCRKSLALELPAAVEPCVREGCVAQGGLAGGQQQRQAPSCAVSSPLRSLPSGT GAFGPVAFSLGLLLVLPAALPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISA LRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYL EYLQNRFESSEEQARAVQMSTKVLIQFLQKKVGVSSFPQLGVGEDRLKDSALDNSGMQCH FQKRRLHVKKRV NT seq 759 nt NT seq  +upstreamnt  +downstreamnt atgaactccgtctccacaagtaagtgcaggaaatccctagccctggaactgccagcagcg gtcgagccctgtgtgagggaggggtgtgtggcccagggagggctggcgggcggccagcag cagaggcaggctcccagctgtgctgtcagctcacccctgcgctcgctcccctccggcaca ggcgccttcggtccagttgccttctccctggggctgctcctggtgttgcctgctgcctta cctgccccagtaccaccaggagaagattccaaagatgtagccgccccacacagacagcca ctcacctcttcagaacgaattgacaaacaaattcggtacatcctcgacggcatctcagcc ctgagaaaggagacttgtaacaagagtaacatgtgtgaaagcagcaaagaggcactggca gaaaacaacctgaaccttccaaagatggctgaaaaagatggatgcttccaatctggattc aatgaggagacttgcctggtgaaaatcatcactggtcttttggagtttgaggtataccta gagtacctccagaacaggtttgagagcagtgaggaacaagccagagctgtgcagatgagt acaaaagtcctgatccagttcctgcagaaaaaggtgggtgtgtcctcattccctcaactt ggtgtgggggaagacaggctcaaagacagtgccctggacaactcagggatgcaatgccac ttccaaaagagaaggctacatgtaaaaaaaagagtctga

DBGET integrated database retrieval system