Pongo pygmaeus (Bornean orangutan): 129044486 Help Entry 129044486         CDS       T10128                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04060   Cytokine-cytokine receptor interaction ppyg04151   PI3K-Akt signaling pathway ppyg04217   Necroptosis ppyg04380   Osteoclast differentiation ppyg04620   Toll-like receptor signaling pathway ppyg04621   NOD-like receptor signaling pathway ppyg04622   RIG-I-like receptor signaling pathway ppyg04623   Cytosolic DNA-sensing pathway ppyg04630   JAK-STAT signaling pathway ppyg04650   Natural killer cell mediated cytotoxicity ppyg04668   TNF signaling pathway ppyg04936   Alcoholic liver disease ppyg05135   Yersinia infection ppyg05142   Chagas disease ppyg05152   Tuberculosis ppyg05160   Hepatitis C ppyg05161   Hepatitis B ppyg05162   Measles ppyg05163   Human cytomegalovirus infection ppyg05164   Influenza A ppyg05165   Human papillomavirus infection ppyg05167   Kaposi sarcoma-associated herpesvirus infection ppyg05168   Herpes simplex virus 1 infection ppyg05169   Epstein-Barr virus infection ppyg05170   Human immunodeficiency virus 1 infection ppyg05171   Coronavirus disease - COVID-19 ppyg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129044486 (IFNB1)    04668 TNF signaling pathway     129044486 (IFNB1)    04151 PI3K-Akt signaling pathway     129044486 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129044486 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129044486 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129044486 (IFNB1)    04621 NOD-like receptor signaling pathway     129044486 (IFNB1)    04622 RIG-I-like receptor signaling pathway     129044486 (IFNB1)    04623 Cytosolic DNA-sensing pathway     129044486 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     129044486 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     129044486 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129044486 (IFNB1)    05161 Hepatitis B     129044486 (IFNB1)    05160 Hepatitis C     129044486 (IFNB1)    05171 Coronavirus disease - COVID-19     129044486 (IFNB1)    05164 Influenza A     129044486 (IFNB1)    05162 Measles     129044486 (IFNB1)    05168 Herpes simplex virus 1 infection     129044486 (IFNB1)    05163 Human cytomegalovirus infection     129044486 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     129044486 (IFNB1)    05169 Epstein-Barr virus infection     129044486 (IFNB1)    05165 Human papillomavirus infection     129044486 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     129044486 (IFNB1)    05152 Tuberculosis     129044486 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     129044486 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129044486 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129044486 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppyg04052]     129044486 (IFNB1) Cytokines and neuropeptides [BR:ppyg04052]  Cytokines   Interferons    129044486 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Forkhead Motif Other DBs NCBI-GeneID:  129044486 NCBI-ProteinID:  XP_054358381 LinkDB All DBs Position 13:36384342..36385180 Genome browser AA seq 187 aa AA seqDB search MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSSFQCQKLLWQLNGRFEYCLKDRMNFD IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK TVLEEKLEKEYFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINR LTGYLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt tccatgagctacaacttgcttggattcctacaaagaagcagcagttttcagtgtcagaag ctcctgtggcaattgaatgggaggtttgaatattgcctcaaggacaggatgaactttgac atccctgaggagattaagcagctgcagcagttccagaaggaggacgccgcattgaccatc tacgagatgctccagaacatctttgctattttcagacaagattcatctagcactggctgg aatgagactattgttgagaacctccttgctaatgtctatcatcagataaaccatctgaag acagttctggaagaaaaactggagaaagaatatttcaccaggggaaaattcatgagcagt ctgcacctgaaaagatattatgggaggattctgcattacctgaaggccaaggagtacagt cactgtgcctggaccatagtcagagtggaaatcctcaggaactttttcttcattaacaga cttacaggttacctccgaaactga

DBGET integrated database retrieval system