Podarcis raffonei (Aeolian wall lizard): 128413210 Help Entry 128413210         CDS       T09310                                  Symbol TMSB4X Name (RefSeq) thymosin beta-4   KO K05764   thymosin, beta 4 Organism praf  Podarcis raffonei (Aeolian wall lizard) Pathway praf04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:praf00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     128413210 (TMSB4X)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:praf04812]     128413210 (TMSB4X) Cytoskeleton proteins [BR:praf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      128413210 (TMSB4X) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin WH2 Qua1 Motif Other DBs NCBI-GeneID:  128413210 NCBI-ProteinID:  XP_053243206 LinkDB All DBs Position 4:complement(68546143..68548569) Genome browser AA seq 44 aa AA seqDB search MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaaccagatatggctgaaatcgagaaattcgacaagtctaagttgaagaag acggaaacgcaagagaaaaacccactgccttcaaaagaaacaattgaacaggagaagcaa gcgggtgaatcgtaa

DBGET integrated database retrieval system