Podarcis raffonei (Aeolian wall lizard): 128413647 Help Entry 128413647         CDS       T09310                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism praf  Podarcis raffonei (Aeolian wall lizard) Pathway praf04060   Cytokine-cytokine receptor interaction praf04672   Intestinal immune network for IgA production praf04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:praf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128413647 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     128413647 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     128413647 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:praf04052]     128413647 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:praf00536]     128413647 (CXCL12) Cytokines and neuropeptides [BR:praf04052]  Cytokines   Chemokines    128413647 (CXCL12) Glycosaminoglycan binding proteins [BR:praf00536]  Heparan sulfate / Heparin   Chemokines    128413647 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  128413647 NCBI-ProteinID:  XP_053243859 LinkDB All DBs Position 5:12749595..12771394 Genome browser AA seq 94 aa AA seqDB search MDSKAAFLALLLLLGTLRAADGKPISLTYRCPCRYFESNVAKSHVKHLKILTVPGCSLQI IARLKNSSKQICVDPKLRWIQEYLEKYLHKRFKM NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggacagcaaagccgccttcctcgccttgctgctgctcctcgggaccctccgcgccgcc gacgggaagcccatcagcctgacttaccgctgcccatgcagatattttgagagcaatgta gccaaatcccatgtgaagcacctgaagatcttgactgtccccggctgttctctgcagatc atcgcaagactgaaaaacagcagcaaacagatctgcgtcgatcccaagttaaggtggatt caagagtacctggagaaatacctgcacaagagattcaagatgtaa

DBGET integrated database retrieval system