Pieris rapae (cabbage white): 110992069 Help Entry 110992069         CDS       T05162                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism prap  Pieris rapae (cabbage white) Pathway prap00510   N-Glycan biosynthesis prap00513   Various types of N-glycan biosynthesis prap04141   Protein processing in endoplasmic reticulum Module prap_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:prap00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     110992069    00513 Various types of N-glycan biosynthesis     110992069  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110992069 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 CAAD Pox_E2-like Motif Other DBs NCBI-GeneID:  110992069 NCBI-ProteinID:  XP_022113427 LinkDB All DBs Position 8:complement(10713889..10714431) Genome browser AA seq 81 aa AA seqDB search MTLEIESMVRHVSPINPAVFPHLTLLLLSIGIFFTAWFFVYEVTSTKSSRDLFKELLLSL VASLFSGFGILFLLLWVGIYV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgactctggagatagaatcaatggttcgtcatgtatctccaatcaacccggctgtgttt ccgcatcttactctgcttctcttaagcattggaatattctttacagcatggttcttcgtg tacgaagtaacaagcacaaagagctccagagatttatttaaggagctcctgttatcatta gtagcatccctgttttcagggtttggtatcttgtttttattactttgggtaggcatatat gtctag

DBGET integrated database retrieval system