Poecilia reticulata (guppy): 103463523 Help Entry 103463523         CDS       T05149                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism pret  Poecilia reticulata (guppy) Pathway pret03030   DNA replication pret03410   Base excision repair pret03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pret00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     103463523 (pole4)    03410 Base excision repair     103463523 (pole4)    03420 Nucleotide excision repair     103463523 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pret03032]     103463523 (pole4)    03400 DNA repair and recombination proteins [BR:pret03400]     103463523 (pole4) Enzymes [BR:pret01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      103463523 (pole4) DNA replication proteins [BR:pret03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     103463523 (pole4) DNA repair and recombination proteins [BR:pret03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       103463523 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  103463523 NCBI-ProteinID:  XP_008405129 UniProt:  A0A3P9PBB4 LinkDB All DBs Position LG4:complement(26220411..26222618) Genome browser AA seq 131 aa AA seqDB search MAATVEAPVPAEQDSARCGPEEENRGAEVEEKSQQQQQQTGSTGPAVPHSRLSKLPLARI KALMKTDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAI DEFAFLEGTLD NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcagctacagtagaagcgcctgtcccagcggagcaggactctgcgcggtgcgggcct gaagaggagaaccgcggggcggaggtggaggagaagagccagcagcagcagcagcagaca ggctccaccgggcccgccgttcctcacagccgtctgtccaaactcccgctggcccgcatc aaagctctgatgaagaccgacccagacgtgtccctcgccagccaagagtccgtgttcatc atcgctaaagccacggaattgtttgttgagatgattgccaaagacgctcttgtgtacgcc cagcaaggaaagaggaaaacattacaaagaaaagacttggacaatgctattgaggccata gatgagtttgctttcctagagggtacgctagattaa

DBGET integrated database retrieval system