Poecilia reticulata (guppy): 103464854 Help Entry 103464854         CDS       T05149                                  Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism pret  Poecilia reticulata (guppy) Pathway pret04060   Cytokine-cytokine receptor interaction pret04672   Intestinal immune network for IgA production pret04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pret00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103464854  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103464854  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     103464854  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pret04052]     103464854    00536 Glycosaminoglycan binding proteins [BR:pret00536]     103464854 Cytokines and neuropeptides [BR:pret04052]  Cytokines   Chemokines    103464854 Glycosaminoglycan binding proteins [BR:pret00536]  Heparan sulfate / Heparin   Chemokines    103464854 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103464854 NCBI-ProteinID:  XP_008407475 UniProt:  A0A3P9MT49 LinkDB All DBs Position LG1:8979687..8991969 Genome browser AA seq 102 aa AA seqDB search MDVKLLALMTLLAVVMQVPTANAKPISLVERCWCRTTLNTVSQRSIKELKFLHTPNCPFQ VIAKLKNNREVCINPETKWLQGYLKNAINKVKKSKRRNTKKV NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggacgtcaagctgctggcgctgatgactctgctggccgtggtcatgcaggttcccact gcaaacgccaagcccatcagtctggtggagcgctgctggtgtcgcaccacgctcaacacc gtctctcagcgctccatcaaggagctcaagtttctccacacccccaactgccccttccaa gtcattgctaaactgaagaacaacagggaggtttgcatcaaccctgagaccaagtggttg caaggatacctgaagaacgccatcaacaaggtgaaaaaatccaagagacgcaacaccaag aaagtctaa

DBGET integrated database retrieval system