Phodopus roborovskii (desert hamster): 127213212 Help Entry 127213212         CDS       T08852                                  Symbol Nppa Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04022   cGMP-PKG signaling pathway prob04024   cAMP signaling pathway prob04066   HIF-1 signaling pathway prob04081   Hormone signaling prob04270   Vascular smooth muscle contraction prob04714   Thermogenesis prob04921   Oxytocin signaling pathway prob04923   Regulation of lipolysis in adipocytes prob04924   Renin secretion prob04925   Aldosterone synthesis and secretion prob05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     127213212 (Nppa)    04024 cAMP signaling pathway     127213212 (Nppa)    04022 cGMP-PKG signaling pathway     127213212 (Nppa)   09133 Signaling molecules and interaction    04081 Hormone signaling     127213212 (Nppa)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     127213212 (Nppa)    04921 Oxytocin signaling pathway     127213212 (Nppa)    04924 Renin secretion     127213212 (Nppa)    04925 Aldosterone synthesis and secretion     127213212 (Nppa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     127213212 (Nppa)   09159 Environmental adaptation    04714 Thermogenesis     127213212 (Nppa)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     127213212 (Nppa)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127213212 (Nppa) Cytokines and neuropeptides [BR:prob04052]  Neuropeptides   Unclassified    127213212 (Nppa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  127213212 NCBI-ProteinID:  XP_051029479 UniProt:  A0AAV0AAC5 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MGSFSITMGVILLLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKMPLEDEVVPPQ ALSDQSDEAPGAALSSVPEVPSWTGEVNPPQRDSSTLGRSPWDPSDRSALLKSKLRALLA APRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggctccttctccatcaccatgggtgtcatcctcctcctggccttttggcttccaggc catattggagcaaaccctgtatacagtgcagtgtccaacacagatctgatggatttcaag aacctgctagaccatctggaggagaagatgccgttagaagacgaggtcgtgcccccacag gccctgagtgaccagagcgatgaagcaccaggggcagcacttagctctgtccctgaggtt ccttcctggactggggaggtcaacccacctcagagagacagcagcacccttgggcgcagc ccctgggacccctccgatagatctgccctcttgaaaagcaaactgagggctctgctggct gcccctcggagcctacggaggtccagctgcttcgggggtaggatcgacaggattggagcc cagagcggactgggatgcaatagcttccggtaccgaagataa

DBGET integrated database retrieval system