Phodopus roborovskii (desert hamster): 127215719 Help Entry 127215719         CDS       T08852                                  Symbol Rap1b Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04010   MAPK signaling pathway prob04014   Ras signaling pathway prob04015   Rap1 signaling pathway prob04024   cAMP signaling pathway prob04062   Chemokine signaling pathway prob04510   Focal adhesion prob04520   Adherens junction prob04611   Platelet activation prob04670   Leukocyte transendothelial migration prob04720   Long-term potentiation prob04722   Neurotrophin signaling pathway prob04934   Cushing syndrome prob04972   Pancreatic secretion prob05211   Renal cell carcinoma prob05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127215719 (Rap1b)    04014 Ras signaling pathway     127215719 (Rap1b)    04015 Rap1 signaling pathway     127215719 (Rap1b)    04024 cAMP signaling pathway     127215719 (Rap1b)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     127215719 (Rap1b)    04520 Adherens junction     127215719 (Rap1b)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     127215719 (Rap1b)    04670 Leukocyte transendothelial migration     127215719 (Rap1b)    04062 Chemokine signaling pathway     127215719 (Rap1b)   09154 Digestive system    04972 Pancreatic secretion     127215719 (Rap1b)   09156 Nervous system    04720 Long-term potentiation     127215719 (Rap1b)    04722 Neurotrophin signaling pathway     127215719 (Rap1b)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     127215719 (Rap1b)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127215719 (Rap1b)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     127215719 (Rap1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prob04147]     127215719 (Rap1b)    04031 GTP-binding proteins [BR:prob04031]     127215719 (Rap1b) Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127215719 (Rap1b)   Exosomal proteins of other body fluids (saliva and urine)    127215719 (Rap1b)   Exosomal proteins of colorectal cancer cells    127215719 (Rap1b) GTP-binding proteins [BR:prob04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     127215719 (Rap1b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  127215719 NCBI-ProteinID:  XP_051032148 UniProt:  A0AAU9YW61 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatataagctagtcgttcttggctcgggaggtgtcggaaagtcggctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagactcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacagttcacagccatgagagacctgtacatgaagaacggccagggcttcgccttg gtgtactccatcacagcacaatccacctttaatgacctgcaggacctgagagagcagatt ctccgggtgaaggacactgatgatgttccaatgattctggttgggaataagtgtgacttg gaagacgaaagagttgtcggaaaggaacaaggccagaacctagcaagacagtggaacaac tgtgcattcttagagtcctctgcaaagtcaaaaataaacgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaaccccagtgcctgggaaggcccgcaaaaagtcttca tgtcaactgctttaa

DBGET integrated database retrieval system